y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G260900.1
FamilyGT35
Protein PropertiesLength: 838 Molecular Weight: 95287.4 Isoelectric Point: 6.4792
ChromosomeChromosome/Scaffold: 13 Start: 57536466 End: 57542844
Descriptionalpha-glucan phosphorylase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351108320
  ALNKLGHELEEIAEQEKDAALGNGGLGRLASCFLDSMATLNLPAWGYGLRYKYGLFKQLITKQGQEEIAEDWLEKFSPWEVVRHDIVFPVRFFGSIEINP
  DGSRKWVGGEVVQALAYDVPIPGYKTKNTISLRLWEAKGRAEDFNLFQFNDGQYESAAQLHSRAQQICAVLYPGDATEDGKLLRLKQQFFLCSASLQDII
  LRFKERRSGKGSWKWSEFPSKVAVQLNDTHPTLAIPELMRLLMDDERLGWDEAWDVTTRTIAYTNHTVLPEALEKWSQPVMWKLLPRHMEIIEEIDKRFL
  AMINATRPDLEHKLPTMRVLDHNPQKPVVRMANLCVVSAHTVNGVAQLHSDILKAELFADYVSIWPTKFQNKTNGITPRRWLRFCSPELSNIITKWLKTD
  QWVTNLDLLSGLREFADNADFQDEWASAKMANKQRLAQYILRVTGVSIDPNSLFDIQVKRIHEYKRQLLNILGAIYRYKKLKEMSPELRKNTTSRTIMIG
  GKAFATYTNAKRIVKLVNDVGAVVNNDPEVNSYLKVVFVPNYNVSVAEMLIPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEIGEE
  NFFLFGARADEVPQLRKDRENGLFKPDPRFEEAKQFIRSGAFGSYDYNPLLDSLEGNSGYGRGDYFLVGHDFPDYMDAQARVDEAYKDRKKWLKMSILST
  AGSGKFSSDRTIAQYAKEIWNIE
Full Sequence
Protein Sequence     Length: 838     Download
MAENGKSATE KVPAVANPLS EQPSEIASNI NYHAQFSPHF SPFKFEPEQA FFATAESVRD    60
RLVKQWNETF LHYHKVDPKQ TYYLSMEYLQ GRALTNAIGN LDIQNAYAEA LNKLGHELEE    120
IAEQEKDAAL GNGGLGRLAS CFLDSMATLN LPAWGYGLRY KYGLFKQLIT KQGQEEIAED    180
WLEKFSPWEV VRHDIVFPVR FFGSIEINPD GSRKWVGGEV VQALAYDVPI PGYKTKNTIS    240
LRLWEAKGRA EDFNLFQFND GQYESAAQLH SRAQQICAVL YPGDATEDGK LLRLKQQFFL    300
CSASLQDIIL RFKERRSGKG SWKWSEFPSK VAVQLNDTHP TLAIPELMRL LMDDERLGWD    360
EAWDVTTRTI AYTNHTVLPE ALEKWSQPVM WKLLPRHMEI IEEIDKRFLA MINATRPDLE    420
HKLPTMRVLD HNPQKPVVRM ANLCVVSAHT VNGVAQLHSD ILKAELFADY VSIWPTKFQN    480
KTNGITPRRW LRFCSPELSN IITKWLKTDQ WVTNLDLLSG LREFADNADF QDEWASAKMA    540
NKQRLAQYIL RVTGVSIDPN SLFDIQVKRI HEYKRQLLNI LGAIYRYKKL KEMSPELRKN    600
TTSRTIMIGG KAFATYTNAK RIVKLVNDVG AVVNNDPEVN SYLKVVFVPN YNVSVAEMLI    660
PGSELSQHIS TAGMEASGTS NMKFALNGCL IIGTLDGANV EIREEIGEEN FFLFGARADE    720
VPQLRKDREN GLFKPDPRFE EAKQFIRSGA FGSYDYNPLL DSLEGNSGYG RGDYFLVGHD    780
FPDYMDAQAR VDEAYKDRKK WLKMSILSTA GSGKFSSDRT IAQYAKEIWN IEECQVP*      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase027831813+
TIGR02093P_ylase030831810+
pfam00343Phosphorylase0110833729+
PRK14985PRK14985083829753+
COG0058GlgP020832819+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM29154.1028368839starch phosphorylase type H [Citrus hybrid cultivar]
DDBJBAG31926.10783713843alpha-1,4-glucan phosphorylase H isozyme [Cucurbita maxima]
RefSeqXP_002280732.1028376843PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313399.10883724853predicted protein [Populus trichocarpa]
RefSeqXP_002520435.10983721849glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A02183223829A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2ffr_A02183211817A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylam
PDB4el5_A02183211817A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylam
PDB4el0_A02183211817A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylam
PDB4eky_A02183211817A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylam
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7822004121665770
HO4180365392367530
HO5862525522848340
CO0821042953146080
HO6139544993898380
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.3Gorai.006G011500.7.330.728Gorai.006G011500.7.330.728
Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978Gorai.006G011500.2.583.981
Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1Gorai.013G092200.2
Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504Gorai.006G011500.4.111.435
Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504Gorai.006G011500.2.180.504
Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815Gorai.006G011500.5.583.818
Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)