y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g04920.1
FamilyGT4
Protein PropertiesLength: 515 Molecular Weight: 57975.3 Isoelectric Point: 7.2342
ChromosomeChromosome/Scaffold: 1 Start: 2275067 End: 2278872
Descriptionsulfoquinovosyldiacylglycerol 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43054532.2e-35
  EPEKPLIIHVGRFGREKNLDFLKTVMDRLPGVRIAFIGDGPYRSELEKMFEGMPAVFTGMMQGEELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVV
  AARAGGVPDIIPEDQEGKTSFLFTPGDLEDCLGKIQLLLTDKEFRDNMG
Full Sequence
Protein Sequence     Length: 515     Download
MEYPPQFPTP QLHTPISSSS SSSSSPRLYT RRVELLLLLF LAPPQHRRLE AHANAGSEEK    60
DCFFFFFCVC AVFLGFLAMV IGAEIKDEME EAPPLLLDEA ARPRRVALFV EPSPFAYISG    120
YKNRFQNFIK HLREMGDEVI VVTNHEGVPQ EFHGAKVIGS WSFPCPMYGK VPLSLALSPR    180
IISEVAKFKP DIIHASSPGI MVFGALAIAK LLGVPLVMSY HTHVPVYIPR YTFSWLVEPM    240
WQVIRFLHRA ADLTLVPSVA ISKDFETAHV ISANRIRLWN KGVDSASFHP KFRSHEMRVR    300
LSDGEPEKPL IIHVGRFGRE KNLDFLKTVM DRLPGVRIAF IGDGPYRSEL EKMFEGMPAV    360
FTGMMQGEEL SQAYASGDVF VMPSESETLG QVVLESMSSG VPVVAARAGG VPDIIPEDQE    420
GKTSFLFTPG DLEDCLGKIQ LLLTDKEFRD NMGMTARAEM EKCDWRAASK KIRNEFYNAA    480
IWYWRKKRAE LIKPLQWLAQ MFLPAPEVNR ITQH*                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like1.0e-34106480395+
TIGR00032argG4.0e-51105458366+
cd03801GT1_YqgM_like7.0e-53105477383+
TIGR00009L282.0e-107105468367+
PLN02871PLN02871078510434+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0006950response to stress
GO:0007154cell communication
GO:0008152metabolic process
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY72486.10795141436hypothetical protein OsI_00342 [Oryza sativa Indica Group]
RefSeqNP_001041991.10795141436Os01g0142300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001144658.10825135436hypothetical protein LOC100277683 [Zea mays]
RefSeqXP_002309122.10835077433predicted protein [Populus trichocarpa]
RefSeqXP_002457385.10905136429hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.0000000000000113048338383A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.0000000000000113048338383A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.0000000000000113048338383A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.0000000000000113048338383A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.0000000000000113048338383A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
6385
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ6634792541053580
HO8131183191534710
CB622917251743240
FL7641732461543990
CB6229171943610.091
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00305.1Aquca_053_00022.3Aquca_053_00022.2Aquca_053_00022.1
Arabidopsis lyrata860579323188
Arabidopsis thalianaAT5G01220.1AT3G45100.2AT3G45100.1
Brachypodium distachyonBradi1g59860.1Bradi2g02800.1Bradi1g67200.1Bradi1g32610.1
Brassica rapaBra009633Bra005694Bra009589
Carica papayaevm.model.supercontig_163.3evm.model.supercontig_65.21
Capsella rubellaCarubv10000742mCarubv10019008m
Chlamydomonas reinhardtiiCre01.g038550.t1.3Cre16.g689150.t1.2Cre01.g006800.t1.3
Citrus clementinaCiclev10011473mCiclev10001141mCiclev10001076m
Citrus sinensisorange1.1g022615morange1.1g017114morange1.1g016648morange1.1g009759morange1.1g027511m
Cucumis sativusCucsa.176160.1Cucsa.143020.1
Eucalyptus grandisEucgr.A00516.1Eucgr.J00902.1
Fragaria vescamrna18817.1-v1.0-hybridmrna24819.1-v1.0-hybrid
Glycine maxGlyma03g14200.1Glyma01g27840.1Glyma18g42540.1Glyma07g17680.4Glyma07g17680.3
Glyma07g17680.2Glyma07g17680.1Glyma20g12140.9Glyma20g12140.8Glyma20g12140.7
Glyma20g12140.6Glyma20g12140.5Glyma20g12140.4Glyma20g12140.3Glyma20g12140.2
Glyma20g12140.10Glyma13g25060.1
Gossypium raimondiiGorai.012G112200.2Gorai.012G112200.1Gorai.002G261700.2Gorai.002G261700.6Gorai.002G261700.4
Gorai.002G261700.3Gorai.002G261700.1Gorai.003G143800.9Gorai.003G143800.8Gorai.003G143800.7
Gorai.003G143800.6Gorai.003G143800.5Gorai.003G143800.4Gorai.003G143800.3Gorai.003G143800.2
Gorai.003G143800.10Gorai.003G143800.1
Linum usitatissimumLus10004832Lus10002499Lus10024892Lus10022925
Malus domesticaMDP0000899469MDP0000143617MDP0000297386MDP0000273680MDP0000203472
MDP0000184748MDP0000198677
Manihot esculentacassava4.1_007989mcassava4.1_005643mcassava4.1_032287m
Medicago truncatulaMedtr4g015260.1Medtr7g067340.1
Mimulus guttatusmgv1a004620mmgv1a004551mmgv1a006150mmgv1a006148m
Oryza sativaLOC_Os07g01030.1LOC_Os03g15840.1LOC_Os07g16960.1
Panicum virgatumPavirv00011082mPavirv00023556mPavirv00064963mPavirv00000330mPavirv00022111m
Pavirv00063251mPavirv00030308mPavirv00006595mPavirv00056553mPavirv00006877m
Physcomitrella patensPp1s24_194V6.1Pp1s106_103V6.1
Phaseolus vulgarisPhvul.010G005100.1Phvul.008G106900.1Phvul.005G132400.1Phvul.002G226400.1
Picea abiesMA_158718g0080MA_60607g0010MA_159042g1330MA_159118g0680MA_159090g0090
MA_159042g1140
Populus trichocarpaPotri.016G112600.4Potri.016G112600.3Potri.016G112600.2Potri.016G112600.1Potri.006G097600.3
Potri.006G097600.2Potri.006G097600.1Potri.016G130000.1
Prunus persicappa004263mppa005676mppa018035m
Ricinus communis35899.m00002429969.m00027234675.m00002848584.m00001330418.m000015
32791.m00002229638.m00053127698.m000067
Setaria italicaSi020690mSi001496mSi035897mSi035683m
Selaginella moellendorffii170091406541
Sorghum bicolorSb02g000240.1Sb03g006480.1Sb01g040150.1Sb02g008800.1
Thellungiella halophilaThhalv10013276mThhalv10002532m
Vitis viniferaGSVIVT01033998001GSVIVT01024777001
Volvox carteriVocar20009459mVocar20001320m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)