y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g33230.1
FamilyGT28
Protein PropertiesLength: 372 Molecular Weight: 40285.1 Isoelectric Point: 9.8949
ChromosomeChromosome/Scaffold: 1 Start: 18298135 End: 18303981
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282553536.3e-26
  LLVLGGTEGSPEINVALLNMYYEMLRERRNRYIIWQTGPEGFCEMESLVRSHRRLLLTPFLHELDKAYAAADVVVSRAGSMSCTEVLVTGKPSILVSYT
Full Sequence
Protein Sequence     Length: 372     Download
MAATARPAPR PLPLPLPRSP LLPRFTQYNS PDDPPRGLRG ARRLTLSPSP ARRRARSLHL    60
RCRLSDSASD PDPLRVAFAC GGAGGHVYAA IALADELHAS LPSSASLFLG APPPSLESDA    120
AASAPYPFAP IPRCLPHAVL DAALHLRRFR PHVLVATGGA PALPACLAAL LLGVPFVIQD    180
QDAGPAPATR LLAPLARRIF LGFNAPVRLL PKRKCAVYGN PVRMSIRKCR ISKADAMASF    240
FPRIGTVGEE GVEVLLVLGG TEGSPEINVA LLNMYYEMLR ERRNRYIIWQ TGPEGFCEME    300
SLVRSHRRLL LTPFLHELDK AYAAADVVVS RAGSMSCTEV LVTGKPSILV SYTVMELHFF    360
STYVLYVFYL L*                                                        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04101Glyco_tran_28_C4.0e-1028235275+
TIGR01133murG2.0e-2075352296+
COG0707MurG1.0e-2575352296+
PRK00726murG7.0e-3473350294+
cd03785GT1_MurG9.0e-4875352295+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0006629lipid metabolic process
GO:0009058biosynthetic process
GO:0009536plastid
GO:0009987cellular process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF05109.2013131313Os01g0516700 [Oryza sativa Japonica Group]
GenBankEAY74292.1013551355hypothetical protein OsI_02179 [Oryza sativa Indica Group]
GenBankEEE54689.102535525355hypothetical protein OsJ_01999 [Oryza sativa Japonica Group]
RefSeqNP_001043195.1013551355Os01g0516700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001149881.108735897370glycosyltransferase family 28 C-terminal domain containing protein [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A1e-17753504278A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B0.000000000000001753528282A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A0.000000000000001753528282A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B0.000000000000001753528282A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A0.000000000000001753528282A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Transmembrane Domains
StartEnd
348370
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES821435308723580
DW243293287843500
ES821129283833450
DR385422295763500
FL766518148872330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brachypodium distachyonBradi2g13780.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Fragaria vescamrna09449.1-v1.0-hybrid
Glycine maxGlyma08g05420.2Glyma05g34250.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.3Gorai.001G067900.1
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny