y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g39810.3
FamilyGT22
Protein PropertiesLength: 530 Molecular Weight: 60491.7 Isoelectric Point: 9.7152
ChromosomeChromosome/Scaffold: 1 Start: 22450498 End: 22456233
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22494590
  LALALAFRAANALLVRTYFNPDEHWQCLEVAHRIVFGYGHLTWEWKRGLRSYLHPFIFAALYKILSLLHLDSPWFMAMAPRLLQSVFASFGDLYLYKLSK
  LIFNNHVAQWALFSQLVNWFMFFCITRTLSNSMETVLTVTGLYYWFVAIESVKGNSVVSKQQAASKQSPPSRKMALLIAALACAIRPTSAITWLYVGLLD
  FIQMKSKSRFIFLEVVPLGVFVLAVTTFLDCWMYGSRIIVPLNFLKFNLFSSGGDYYGTHVFHWYFSQGFPSMIWTFLPFSISGILKSREWRLAGLIVWV
  LVVYSILGHKEFRFVLPVLPFMFMFSGHNLAAMAQLKGKGHNEKGRLSRLKLSVILLILTNVPMALYMSLYHQRGTEDAMLYLSREAHDGRVKSVLFLMP
  CHSTPYYSTLH
Full Sequence
Protein Sequence     Length: 530     Download
MSHRRRRNAA GPPPPEGIGG SSTAEASSTG EERPDLPWAW ALGSERRVLA LALAFRAANA    60
LLVRTYFNPD EHWQCLEVAH RIVFGYGHLT WEWKRGLRSY LHPFIFAALY KILSLLHLDS    120
PWFMAMAPRL LQSVFASFGD LYLYKLSKLI FNNHVAQWAL FSQLVNWFMF FCITRTLSNS    180
METVLTVTGL YYWFVAIESV KGNSVVSKQQ AASKQSPPSR KMALLIAALA CAIRPTSAIT    240
WLYVGLLDFI QMKSKSRFIF LEVVPLGVFV LAVTTFLDCW MYGSRIIVPL NFLKFNLFSS    300
GGDYYGTHVF HWYFSQGFPS MIWTFLPFSI SGILKSREWR LAGLIVWVLV VYSILGHKEF    360
RFVLPVLPFM FMFSGHNLAA MAQLKGKGHN EKGRLSRLKL SVILLILTNV PMALYMSLYH    420
QRGTEDAMLY LSREAHDGRV KSVLFLMPCH STPYYSTLHY NLPMRFLDCT PSENKGTLDE    480
SDRFLMNPAD FVGEVFGNLS SFSHIVLFES EERHVKLLLR NSFQEVKHC*               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_221.0e-9565459413+
PLN02816PLN02816065527480+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
GO:0006464cellular protein modification process
GO:0006506GPI anchor biosynthetic process
GO:0006629lipid metabolic process
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAG91273.1015291529unnamed protein product [Oryza sativa Japonica Group]
GenBankEEC70951.1015271469hypothetical protein OsI_02558 [Oryza sativa Indica Group]
GenBankEEE54860.1015261500hypothetical protein OsJ_02340 [Oryza sativa Japonica Group]
RefSeqNP_001043404.1015271527Os01g0580100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131169.1015272524hypothetical protein LOC100192477 [Zea mays]
Transmembrane Domains
StartEnd
96118
154173
180197
223245
258277
312334
339356
360379
400419
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8453593461665110
JK5027652091393470
GO8455582602715270
JG8325722372604960
JG8325721303875050.0000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4
Gorai.010G092100.3Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny