y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g45460.1
FamilyCE10
Protein PropertiesLength: 339 Molecular Weight: 37159.4 Isoelectric Point: 9.055
ChromosomeChromosome/Scaffold: 1 Start: 25792699 End: 25797614
Descriptionprenylcysteine methylesterase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101113231.10002e-41
  QVRRSIVYGEQPRNRLDLYIPKDINRPCPVVAFVTGGAWIIGYKAWGSLLGRRLAERGIIVACIDYRNFPQGTIGDMVSDASQGISYVCNNIASYGGDPN
  RIYLVGQSAGAHIAACALIEQAVKESSGQSISWSVTQIKAYFGLSGGYNMHSLVDHFHERGLNRSIFFSIMEGEESLSRYSPEIVVKQSSSQTIALLPPI
  VLMHGTEDYSIPS
Full Sequence
Protein Sequence     Length: 339     Download
MRPVSSAEEV GALLSRSDSS GRRRRSSPVQ SASPRPAGCG CGGPRRQSSF RDDVGHAASE    60
TYLVTRLTFS LLQYLGLGYR WMSQLLALTI YAILLMPGFL QVGYYYFFSS QVRRSIVYGE    120
QPRNRLDLYI PKDINRPCPV VAFVTGGAWI IGYKAWGSLL GRRLAERGII VACIDYRNFP    180
QGTIGDMVSD ASQGISYVCN NIASYGGDPN RIYLVGQSAG AHIAACALIE QAVKESSGQS    240
ISWSVTQIKA YFGLSGGYNM HSLVDHFHER GLNRSIFFSI MEGEESLSRY SPEIVVKQSS    300
SQTIALLPPI VLMHGTEDYS IPSSARFLLM PSADVHLR*                           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07859Abhydrolase_34.0e-914622581+
pfam00135COesterase3.0e-10126225112+
cd00312Esterase_lipase2.0e-10126234122+
COG2272PnbA4.0e-11126247144+
COG0657Aes5.0e-20113327224+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0007267cell-cell signaling
GO:0008152metabolic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC71166.10773254258hypothetical protein OsI_03031 [Oryza sativa Indica Group]
GenBankEEE55068.1013251325hypothetical protein OsJ_02788 [Oryza sativa Japonica Group]
RefSeqNP_001043688.1013381338Os01g0642000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132117.1053253320hypothetical protein LOC100193534 [Zea mays]
RefSeqXP_002456038.1053373333hypothetical protein SORBIDRAFT_03g029280 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1jmy_A0.000000000310822065196A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase
PDB2hm7_A0.000000000412524561180A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1evq_A0.000000000512524561180A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB1u4n_A0.000000000612524561180A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB1qz3_A0.000000000612524561180A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate
Transmembrane Domains
StartEnd
86108
138160
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL959136246703150
DY280956281473260
JG945758242843250
DY288531271473160
DY282217254473000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma16g18930.1Glyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)