| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os01g53380.1 |
| Family | GT1 |
| Protein Properties | Length: 154 Molecular Weight: 17387.1 Isoelectric Point: 9.0853 |
| Chromosome | Chromosome/Scaffold: 1 Start: 30671532 End: 30671993 |
| Description | UDP-glucosyl transferase 88A1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 19 | 118 | 1.6e-28 |
| RGLVVMSWAPQRKVLEHSAVGGFVTHCGWNSMLEALTAGVPMLAWPLYAEQRMNKVFLVEEMRLAVAVEGYDKGVVTAEEIQEKARWIMDSNGGRELRER | |||
| Full Sequence |
|---|
| Protein Sequence Length: 154 Download |
| MRVEKAPFPE GFLRRTKGRG LVVMSWAPQR KVLEHSAVGG FVTHCGWNSM LEALTAGVPM 60 LAWPLYAEQR MNKVFLVEEM RLAVAVEGYD KGVVTAEEIQ EKARWIMDSN GGRELRERSL 120 AAMWEVKEAL SDKGEFKIAL LQLTSQWKNY NNS* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02992 | PLN02992 | 1.0e-36 | 8 | 118 | 111 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02167 | PLN02167 | 7.0e-37 | 7 | 139 | 139 | + UDP-glycosyltransferase family protein | ||
| PLN02554 | PLN02554 | 3.0e-39 | 9 | 142 | 142 | + UDP-glycosyltransferase family protein | ||
| PLN00164 | PLN00164 | 1.0e-41 | 9 | 144 | 140 | + glucosyltransferase; Provisional | ||
| PLN03004 | PLN03004 | 3.0e-44 | 5 | 134 | 130 | + UDP-glycosyltransferase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005829 | cytosol |
| GO:0008152 | metabolic process |
| GO:0016740 | transferase activity |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAY75734.1 | 0 | 8 | 153 | 326 | 471 | hypothetical protein OsI_03646 [Oryza sativa Indica Group] |
| GenBank | EAY75735.1 | 0 | 1 | 153 | 1 | 153 | hypothetical protein OsI_03647 [Oryza sativa Indica Group] |
| GenBank | EAZ13452.1 | 0 | 8 | 153 | 295 | 440 | hypothetical protein OsJ_03368 [Oryza sativa Japonica Group] |
| GenBank | EAZ13453.1 | 0 | 1 | 153 | 1 | 153 | hypothetical protein OsJ_03369 [Oryza sativa Japonica Group] |
| RefSeq | NP_001044168.1 | 0 | 8 | 153 | 346 | 491 | Os01g0735300 [Oryza sativa (japonica cultivar-group)] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 2e-36 | 8 | 150 | 328 | 470 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 2vch_A | 2e-36 | 8 | 150 | 328 | 470 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 2vce_A | 2e-36 | 8 | 150 | 328 | 470 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2acw_B | 9e-29 | 4 | 143 | 316 | 457 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acw_A | 9e-29 | 4 | 143 | 316 | 457 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| rose anthocyanin biosynthesis | RXN-8005 | EC-2.4.1 | UDP-D-glucose:cyanidin 5-O-β-D-glucosyltransferase |
| rose anthocyanin biosynthesis | RXN-8006 | EC-2.4.1 | cyanidin 5,3-O-glycosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CI099201 | 130 | 25 | 154 | 0 |
| CB672082 | 142 | 8 | 149 | 0 |
| CI666537 | 125 | 8 | 132 | 0 |
| BJ275225 | 149 | 5 | 153 | 0 |
| CX614480 | 143 | 6 | 148 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |