y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g55040.1
FamilyGT48
Protein PropertiesLength: 1791 Molecular Weight: 207241 Isoelectric Point: 9.5486
ChromosomeChromosome/Scaffold: 1 Start: 31641231 End: 31648756
Descriptionglucan synthase-like 5
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4888716460
  VPKNPEARRRITFFSNSLFMNMPRAPTVQRMMAFSVLTPYYNEDVLYNKDQLRRENEDGISILFYLQKIYEDDWKNFLERMQREGMASDDGIWAGKFQDL
  RLWASYRGQTLARTVRGMMYYYRALKMLAFLDNASEVEITEGTKQLASFGSVQYENDVYPMNGGLSQRPRRRLERGTSTVSQLFKGQEDGAAIMKYTYVV
  ACQIYGNQKKAKDQRAEDILTLMKKNDALRVAYVDEVHPEIGDTQYYSVLVKFDPVLQREVEIYRIRLPGQLKLGEGKPENQNHAIIFTRGDAVQTIDMN
  QDNYFEEALKMRNLLEQYDYYHGSQKPTLLGVREHVFTGSVSSLAWFMSAQETSFVTLGQRVLANPLKVRMHYGHPDVFDRLWFLTRGGISKASRVINIS
  EDIFAGFNCTLRGGNVSHHEYIQVGKGRDVGLNQISMFEAKVSSGNGEQTLSRDIYRLGHRLDFFRSLSVFYTTVGFYFNTMMVVLTVYTFVWGRLYLAL
  SGLEAGIQGSANATNNKALGAVLNQQFVIQLGLFTALPMIIENSLEQGFLPAVWDFFTMQMMFSSVFYTFSMGTKSHYYGRTILHGGAKYRATGRGFVVQ
  HKSFAENYRLYARSHFIKAIELGIVLTVYAAHSVIARDTLVYIIMMISSWFLVVSWIMAPFAFNPSGFDWLKTVYDFDDFMNWIWYPGSIFSKAEHSWEV
  WWFEEQDHLRTTGLWGKILEILLDLRYFFFQYGVVYQLKIANESRSIAVYLLSWICVAVI
Full Sequence
Protein Sequence     Length: 1791     Download
MSLLRNRRAA AAAGSGEQTV VQAAYNIIPI QDVVMHGDHP SLQVPEVRAA VEALSHASDF    60
PAPPLARVWD PHRADIFDWL GATFGFQADN VRNQREHLVL LLANAQLRAA PGFPKDHPID    120
VLHLTVARGI RRKLLKNYTS WCAYLGQKRH FRVPSGGGGG RRTGAATGND VRMDLLYTAL    180
YLLIWGEAAN LRFMPECLCY IFHYMALDLH HVVEQSIDIE TGRPAMPAVC GEDAFLIRVV    240
TPIYNVLKNE VEASRNGTKP HSAWRNYDDV NEYFWSRRVF KRLRWPLDPS RSFFVEPGKT    300
GRIGKTGFVE QRSFWNVYRS FDRVWVMHIL FFQAAMIVAW DGKTPWVSLR FRDIQVRVLS    360
VFITWGGLRF VQAMLDAGTQ YSLVSRETKT VAVRMVLKVL VAAGWTITFS VLYKRMWDQR    420
WRDRRWSFAA NTRVLNYLEA AAVFVIPQVL AIVLFIIPWI RNFLEKTNWK ILYVLTWWFQ    480
TRTFVGRGLR EGLIDNIKYS IFWVCLLVSK FSFSYFLQIK PMVGPTKVIF KLHDIKRNWF    540
EFMPHTERLA VIILWLPVII IYLMDIQIWY AVFSSLTGAL IGLFSHLGEI RSVEQLRLRF    600
QFFASAMQFN LMPEEHLDTV HGGIRSKFYD AINRLKLRYG FGRPYRKIEA NEVEAKRFAL    660
VWNEIIQTFR EEDIISDKEL GLLELPAVVW RIRVVRWPCL LLKNELLLAL SQAAELVADD    720
RTHWNKICNN EYRRCAVIEA YDSIRHLLLE IIKERTNEHI IVNQLFLAFD GAMEYGKFTE    780
EYRLTLLPQI HKYVISLVEQ LLLKDKDQIK IVRTLQDLYD LAVHDFPKIK KDFEQLRREG    840
LALSRPTESQ LLFQDAIKCP DDNDVSFYKQ VRRLHTILTS RDSMDDVPKN PEARRRITFF    900
SNSLFMNMPR APTVQRMMAF SVLTPYYNED VLYNKDQLRR ENEDGISILF YLQKIYEDDW    960
KNFLERMQRE GMASDDGIWA GKFQDLRLWA SYRGQTLART VRGMMYYYRA LKMLAFLDNA    1020
SEVEITEGTK QLASFGSVQY ENDVYPMNGG LSQRPRRRLE RGTSTVSQLF KGQEDGAAIM    1080
KYTYVVACQI YGNQKKAKDQ RAEDILTLMK KNDALRVAYV DEVHPEIGDT QYYSVLVKFD    1140
PVLQREVEIY RIRLPGQLKL GEGKPENQNH AIIFTRGDAV QTIDMNQDNY FEEALKMRNL    1200
LEQYDYYHGS QKPTLLGVRE HVFTGSVSSL AWFMSAQETS FVTLGQRVLA NPLKVRMHYG    1260
HPDVFDRLWF LTRGGISKAS RVINISEDIF AGFNCTLRGG NVSHHEYIQV GKGRDVGLNQ    1320
ISMFEAKVSS GNGEQTLSRD IYRLGHRLDF FRSLSVFYTT VGFYFNTMMV VLTVYTFVWG    1380
RLYLALSGLE AGIQGSANAT NNKALGAVLN QQFVIQLGLF TALPMIIENS LEQGFLPAVW    1440
DFFTMQMMFS SVFYTFSMGT KSHYYGRTIL HGGAKYRATG RGFVVQHKSF AENYRLYARS    1500
HFIKAIELGI VLTVYAAHSV IARDTLVYII MMISSWFLVV SWIMAPFAFN PSGFDWLKTV    1560
YDFDDFMNWI WYPGSIFSKA EHSWEVWWFE EQDHLRTTGL WGKILEILLD LRYFFFQYGV    1620
VYQLKIANES RSIAVYLLSW ICVAVIFGIF VLMSYARDKY AAKQHLYYRV IQSGVIILAV    1680
LVLIIFLKFT KFQIIDIFTS LLAFIPTGWG LISIAQVIRP FIESTVVWAS VVSVARLYEI    1740
LLGVFVMAPV AFFSWLPGFQ EMQTRVLFNE AFSRGLQISR ILAGKKTIAV *             1800
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom13.0e-56172288117+
pfam02364Glucan_synthase08871666868+
Gene Ontology
GO TermDescription
GO:0000003reproduction
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0005575cellular_component
GO:0005886plasma membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACS36253.10166179011626glucan synthase-like 7 [Hordeum vulgare]
DDBJBAD87286.10173179011618putative callose synthase 1 catalytic subunit [Oryza sativa Japonica Group]
GenBankEAZ13575.101136611366hypothetical protein OsJ_03491 [Oryza sativa Japonica Group]
GenBankEAZ13575.18e-381591179013341533hypothetical protein OsJ_03491 [Oryza sativa Japonica Group]
RefSeqNP_001044278.101179011790Os01g0754200 [Oryza sativa (japonica cultivar-group)]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
324341
354371
391413
434456
499517
551573
13561378
14051427
14421459
15001522
15271549
16331655
16651687
17001722
17371759
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519629116617890
HO78074653591714460
GO841290292128015710
HO801980234122214530
HO801980172145316240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os06g51270.1LOC_Os03g03610.3LOC_Os03g03610.2
LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1LOC_Os01g48200.1
LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)