CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g63840.1
FamilyGT30
Protein PropertiesLength: 458 Molecular Weight: 50371.7 Isoelectric Point: 9.1085
ChromosomeChromosome/Scaffold: 1 Start: 37039556 End: 37043234
DescriptionKDO transferase A
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT30462270
  RWPERLGRPSVARPRPGSPLVWFHAVSLGEGMAALPVVRHCARLHPGLPILLTTTTLSSFEVMKDLLPDGVIYQFAPLDCPDAIESFIGYWKPNLILLME
  SELWPNLILSAAEKGIAVVLLNARMSLKSFNRWSLPLGLQLVSLMLSKLSLVIPLSTIQAVRFQLLHAPPQIIHFAGDLKYA
Full Sequence
Protein Sequence     Length: 458     Download
MRTARTPASA ARGGRALYEL YRAASRAAAP AALLWRRLRG LEHPSRWPER LGRPSVARPR    60
PGSPLVWFHA VSLGEGMAAL PVVRHCARLH PGLPILLTTT TLSSFEVMKD LLPDGVIYQF    120
APLDCPDAIE SFIGYWKPNL ILLMESELWP NLILSAAEKG IAVVLLNARM SLKSFNRWSL    180
PLGLQLVSLM LSKLSLVIPL STIQAVRFQL LHAPPQIIHF AGDLKYAVGD IAAGEKEVAA    240
IEDLQQQFSN RPIWMAASIH KGEDEIILRV HDELTRAYPT LLLILVPRHP EDSKNVSQTL    300
KKQKVNFVLR STREVVSSNT SIYVVDTLGE LRMLYRVTPI AVIGGSFLPG LAGHNISEAA    360
AVGCAVMTGP SVGHFYHMLV EMWQINPLAV KQVKGEYELL EALKQLLGDS RALEACQRAA    420
KDAFSFMSDG VVNRVWNLVH PFTIGSQTDT CDSFSSS* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04413Glycos_transf_N2.0e-5543228186+
COG1519KdtA7.0e-9942442405+
PRK05749PRK057497.0e-11042442402+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005739mitochondrion
GO:0005975carbohydrate metabolic process
GO:0009058biosynthetic process
GO:0016740transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN31913.1014531450unknown [Zea mays]
GenBankEEC71834.1014571457hypothetical protein OsI_04493 [Oryza sativa Indica Group]
RefSeqXP_002322900.10114405434predicted protein [Populus trichocarpa]
RefSeqXP_002458792.1014531453hypothetical protein SORBIDRAFT_03g040370 [Sorghum bicolor]
RefSeqXP_002528642.10843734333-deoxy-d-manno-octulosonic-acid transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2xcu_D5e-276641943356A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2xcu_C5e-276641943356A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2xcu_B5e-276641943356A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2xcu_A5e-276641943356A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2xci_D5e-276641943356A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase Waaa Of Aquifex Aeolicus, Substrate-Free Form
Metabolic Pathways
Pathway NameReactionECProtein Name
KDO transfer to lipid IVA IKDOTRANS-RXNEC-2.4.99.12lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
KDO transfer to lipid IVA IKDOTRANS2-RXNEC-2.4.99.13(KDO)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB67594828232840
DV5033462372174530
CB6759491782814580
DY279419312423530
DY279419613474071.8
Orthologous Group
SpeciesID
Arabidopsis lyrata325028
Arabidopsis thalianaAT5G03770.1
Brachypodium distachyonBradi2g55417.1
Brassica rapaBra009511
Carica papayaevm.model.supercontig_5.99
Capsella rubellaCarubv10000940m
Chlamydomonas reinhardtiiCre13.g583100.t1.3
Citrus clementinaCiclev10032390mCiclev10032645m
Cucumis sativusCucsa.039090.1
Eucalyptus grandisEucgr.A01566.1
Fragaria vescamrna30104.1-v1.0-hybrid
Glycine maxGlyma10g07520.1
Gossypium raimondiiGorai.009G409200.3Gorai.009G409200.4Gorai.009G409200.2Gorai.009G409200.1
Linum usitatissimumLus10033622Lus10017663
Malus domesticaMDP0000133066
Manihot esculentacassava4.1_023442mcassava4.1_007754m
Medicago truncatulaMedtr1g061560.1
Mimulus guttatusmgv1a006467m
Oryza sativaLOC_Os01g63840.2
Panicum virgatumPavirv00040033mPavirv00069505m
Physcomitrella patensPp1s441_14V6.1
Phaseolus vulgarisPhvul.007G224100.1
Picea abiesMA_159008g0430
Populus trichocarpaPotri.016G095900.3Potri.016G095900.6Potri.016G095900.1Potri.016G095900.5Potri.016G095900.2
Potri.016G095900.4
Prunus persicappa025343m
Ricinus communis29815.m000507
Setaria italicaSi001596m
Selaginella moellendorffii76719
Sorghum bicolorSb03g040370.1
Thellungiella halophilaThhalv10013569m
Vitis viniferaGSVIVT01033751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny