y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g65720.1
FamilyGH43
Protein PropertiesLength: 536 Molecular Weight: 60643 Isoelectric Point: 9.4739
ChromosomeChromosome/Scaffold: 1 Start: 38154145 End: 38157111
DescriptionArabinanase/levansucrase/invertase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH432284518.8e-35
  TAKYYWYGENKDGLTYQTHPKSTYRVDIIGVSCYSSKDLWSWTNEGIVLPGEPTNFTHDLHKSKVLERPKVIYNDHTGQYVMWMHIDDANYTKASVGVAV
  SNSPTGPFTYLYSFRPHGFESRDMTIFKDDDGSAYLFYSSRDNTELHVSPLTKDYLNITVAMRRILIRRHREAPAVFKLQGTYYMITSGCSGWAPNRALA
  HAAESIMGPWETLGNPCVGGNRFF
Full Sequence
Protein Sequence     Length: 536     Download
MPSPPAATPR PLPLQVSPLP LCDLCRTPQP PPVDATSATP PTSSPWAPAA RLAPRSGAHP    60
SFLMRINNGR MKMRNKQRKS SALNFDAGCR SSLSFIVWSL VGVALIVCFF SVVRQADTRQ    120
NHIYFRHLSA TRELEEIEEE HFRLPPPHKV NPRAVKRRGP RKAPKVIDQY LDESSAVHAL    180
FFPDERSAVN PTKGGNDSMY FYPGRVWLDT DGHAIQAHGG GILYDHITAK YYWYGENKDG    240
LTYQTHPKST YRVDIIGVSC YSSKDLWSWT NEGIVLPGEP TNFTHDLHKS KVLERPKVIY    300
NDHTGQYVMW MHIDDANYTK ASVGVAVSNS PTGPFTYLYS FRPHGFESRD MTIFKDDDGS    360
AYLFYSSRDN TELHVSPLTK DYLNITVAMR RILIRRHREA PAVFKLQGTY YMITSGCSGW    420
APNRALAHAA ESIMGPWETL GNPCVGGNRF FRLTTFLSQS TFVLPLPGLP GTFIFMADRW    480
NPSNLKDSRY VWLPLFIGGL ADEPLDYSFG FPAWSRVSIY WHRKWRLPES WKGYT*        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd08999GH43_ABN_26.0e-20258443204+
cd09004GH43_bXyl3.0e-20259442196+
cd08990GH43_AXH_like7.0e-23260438193+
cd08978GH_F5.0e-42230497279+
cd08985GH43_61.0e-129215497284+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005575cellular_component
GO:0005975carbohydrate metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY76702.1015351535hypothetical protein OsI_04657 [Oryza sativa Indica Group]
RefSeqNP_001044987.10645351472Os01g0879400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151925.1012953261465glycosyl hydrolase, family 43 protein [Zea mays]
RefSeqXP_002456734.10645321469hypothetical protein SORBIDRAFT_03g041630 [Sorghum bicolor]
RefSeqXP_002468324.1011453247465hypothetical protein SORBIDRAFT_01g043810 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vt2_F020449545328A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3vt2_E020449545328A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3vt2_D020449545328A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3vt2_C020449545328A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3vt2_B020449545328A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Transmembrane Domains
StartEnd
91113
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8561533351985320
JG9067672711744440
GO8017532972355310
JK5891752482524990
JG906767274384645
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_060_00007.3Aquca_060_00007.1Aquca_060_00007.2
Arabidopsis lyrata906305332819
Arabidopsis thalianaAT5G67540.2AT5G67540.1AT3G49880.1
Brachypodium distachyonBradi2g50980.2Bradi1g71160.1Bradi2g50980.1
Brassica rapaBra024441Bra029980Bra036036
Capsella rubellaCarubv10027885mCarubv10019437m
Citrus clementinaCiclev10025553mCiclev10025552mCiclev10025561m
Citrus sinensisorange1.1g011114morange1.1g012300morange1.1g012453m
Cucumis sativusCucsa.366970.1Cucsa.366990.1
Eucalyptus grandisEucgr.I00703.2Eucgr.I00703.1Eucgr.H02307.1
Fragaria vescamrna05759.1-v1.0-hybrid
Glycine maxGlyma05g22470.3Glyma17g17390.3Glyma17g17390.2Glyma17g17390.1Glyma05g22470.6
Glyma05g22470.5Glyma05g22470.4Glyma05g22470.2Glyma01g40190.1Glyma11g05100.1
Gossypium raimondiiGorai.011G214500.1Gorai.008G083400.1Gorai.003G030500.1Gorai.003G030500.2
Linum usitatissimumLus10011543Lus10019280
Malus domesticaMDP0000248963MDP0000503275MDP0000406084
Manihot esculentacassava4.1_032973mcassava4.1_007150mcassava4.1_007066m
Medicago truncatulaMedtr5g015460.1Medtr4g097110.1
Mimulus guttatusmgv1a018781mmgv1a005746m
Oryza sativaLOC_Os12g21789.1LOC_Os12g21789.2
Panicum virgatumPavirv00010178mPavirv00067870mPavirv00058950mPavirv00044467m
Physcomitrella patensPp1s410_9V6.1Pp1s16_243V6.1
Phaseolus vulgarisPhvul.003G234900.1Phvul.002G010600.1
Picea abiesMA_181765g0010
Populus trichocarpaPotri.005G148800.1Potri.005G148800.2
Prunus persicappa005306m
Ricinus communis48021.m00001434138.m00001529661.m000924
Setaria italicaSi001388mSi035531m
Selaginella moellendorffii44066110234
Sorghum bicolorSb03g041630.1Sb01g043810.1
Thellungiella halophilaThhalv10004148mThhalv10010347m
Vitis viniferaGSVIVT01000105001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny