CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g65790.1
FamilyCE8
Protein PropertiesLength: 541 Molecular Weight: 57864.3 Isoelectric Point: 6.6072
ChromosomeChromosome/Scaffold: 1 Start: 38206872 End: 38211799
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82305320
  VTVCGAGCHYKTVGEAVAAAPDYGDEMFVVHVKEGVYKETVNVPLEKTNVVVVGDGMGKTVITGDLNADTPGVSTFNTATVGVLADGFMARDLTISNTAG
  PDAHQAVAFRSTGDRTVLDTVELLGHQDTLYAHAMRQFYTRCRVSGTVDFVFGNSATVLRDTALIVLPRQLRPEKGENDAVTAQGRTDPAQPTGIVLRGC
  VVNGSDDYMALYREKPDVHHVYLGRPWKEYSRTVYVGCTLSEIVQPRGWMAWNGDFALKTLYYGEYESAGPGGDGASGSRIGWSSQVPRDHVDVYSVASF
  IQG
Full Sequence
Protein Sequence     Length: 541     Download
MSPPPLRLLL FLLLLHLPSS LSSRHHHHAP SPSKPAPASY AAPLAVLLAC NATRFQPACV    60
STLSNASADA STPDLLAATL SALRARIPPA VSTARSVLAA SSNVNLTNAA TNCLTFLSFS    120
THRLSPPPST SSPSLLSAST ALLHLYDCWS AYKYVNFSRT ISDAMAYLDD TIAVNSNYIS    180
MLAALQRYGD DTFRWAPPQT ERDGYWPPAA AGSAADEDAL GVPKGLPPNV TVCGAGCHYK    240
TVGEAVAAAP DYGDEMFVVH VKEGVYKETV NVPLEKTNVV VVGDGMGKTV ITGDLNADTP    300
GVSTFNTATV GVLADGFMAR DLTISNTAGP DAHQAVAFRS TGDRTVLDTV ELLGHQDTLY    360
AHAMRQFYTR CRVSGTVDFV FGNSATVLRD TALIVLPRQL RPEKGENDAV TAQGRTDPAQ    420
PTGIVLRGCV VNGSDDYMAL YREKPDVHHV YLGRPWKEYS RTVYVGCTLS EIVQPRGWMA    480
WNGDFALKTL YYGEYESAGP GGDGASGSRI GWSSQVPRDH VDVYSVASFI QGDKWIPKIH    540
*                                                                    600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02990PLN029903.0e-8650537526+
PLN02201PLN022015.0e-87225537324+
PLN02301PLN023011.0e-92223536319+
pfam01095Pectinesterase9.0e-130229533309+
PLN02708PLN02708050540505+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0008150biological_process
GO:0008152metabolic process
GO:0009536plastid
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY76707.1015401540hypothetical protein OsI_04662 [Oryza sativa Indica Group]
RefSeqNP_001044992.1015401540Os01g0880300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002281640.102553723552PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002458861.101553916506hypothetical protein SORBIDRAFT_03g041680 [Sorghum bicolor]
RefSeqXP_002517239.101953719549Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02285367308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A023953615304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B9e-1923645615245A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A9e-1923645615245A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B1e-1823645615245A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC8888532902505390
EE2896072472504960
EC8990752472504960
CK1624552982455410
EE0286872352504840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)