y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os01g71300.1
FamilyCE1
Protein PropertiesLength: 293 Molecular Weight: 32181.6 Isoelectric Point: 7.88
ChromosomeChromosome/Scaffold: 1 Start: 41251226 End: 41272319
DescriptionS-formylglutathione hydrolase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1342860
  SATLGCPMTFSVFLPPSPASDLPVLYWLSGLTCNDENFVTKAGAQRAAAAHGIALVAPDTSPRGLNIEGEADSWDFGVGAGFYLNATNEKWKNWRMYDYV
  VKELPKVLSDNFEQLNTSRASIFGHSMGGHGALTIYLKNTDKYKSVSAFSPVVNPINCPWGQKAFSNYLGPAKSDWKEYDATCLIKKCNKISTPILIDQG
  EDDKFLAKQLLPRNFEEACKAVGAPLTLRMQPGYDHSYFFIATFIDDHIAHHS
Full Sequence
Protein Sequence     Length: 293     Download
MAAAAPSPPP VAALEQMSRT KMFGGHNLRF RHHSATLGCP MTFSVFLPPS PASDLPVLYW    60
LSGLTCNDEN FVTKAGAQRA AAAHGIALVA PDTSPRGLNI EGEADSWDFG VGAGFYLNAT    120
NEKWKNWRMY DYVVKELPKV LSDNFEQLNT SRASIFGHSM GGHGALTIYL KNTDKYKSVS    180
AFSPVVNPIN CPWGQKAFSN YLGPAKSDWK EYDATCLIKK CNKISTPILI DQGEDDKFLA    240
KQLLPRNFEE ACKAVGAPLT LRMQPGYDHS YFFIATFIDD HIAHHSQFLK SA*           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1506DAP20.000389285219+
pfam00756Esterase3.0e-5034284264+
COG0627COG06277.0e-8514292310+
TIGR02821fghA_ester_D4.0e-12815289277+
PLN02442PLN02442014291279+
Gene Ontology
GO TermDescription
GO:0004091carboxylesterase activity
GO:0005576extracellular region
GO:0006508proteolysis
GO:0008150biological_process
GO:0008152metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11734.10162907283S-formylglutathione hydrolase [Gossypium hirsutum]
RefSeqNP_001045351.1012921292Os01g0939700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148438.1052922290esterase D [Zea mays]
RefSeqXP_002284489.10162897282PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002456916.10122923284hypothetical protein SORBIDRAFT_03g045400 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fcx_B0132912282A Chain A, Crystal Structure Of Human Esterase D
PDB3fcx_A0132912282A Chain A, Crystal Structure Of Human Esterase D
PDB3s8y_A0132913280A Chain A, Bromide Soaked Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_B0132913280A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_A0132913280A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
Metabolic Pathways
Pathway NameReactionECProtein Name
formaldehyde oxidation II (glutathione-dependent)S-FORMYLGLUTATHIONE-HYDROLASE-RXNEC-3.1.2.12S-formylglutathione hydrolase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT848008280142930
EG384989280142930
CJ684473272222930
FF349243273142860
CO446000267192840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00724.1Aquca_014_00724.3Aquca_014_00724.2
Arabidopsis lyrata903473
Arabidopsis thalianaAT2G41530.1
Brachypodium distachyonBradi2g60400.1
Brassica rapaBra000230Bra004627
Carica papayaevm.model.supercontig_182.15
Capsella rubellaCarubv10023793m
Chlamydomonas reinhardtiiCre03.g158800.t3.1Cre03.g158800.t1.3Cre03.g158800.t2.1
Citrus clementinaCiclev10005572m
Citrus sinensisorange1.1g023324morange1.1g024077m
Eucalyptus grandisEucgr.K02019.2Eucgr.K01713.1Eucgr.K02019.1
Fragaria vescamrna21972.1-v1.0-hybrid
Glycine maxGlyma10g15910.1Glyma02g33350.1
Gossypium raimondiiGorai.002G227600.1Gorai.002G227600.2Gorai.002G227600.3
Linum usitatissimumLus10031051Lus10035437Lus10042038
Malus domesticaMDP0000130742MDP0000878750
Manihot esculentacassava4.1_014031mcassava4.1_013351m
Mimulus guttatusmgv1a011293m
Oryza sativaLOC_Os01g71300.2
Panicum virgatumPavirv00039463mPavirv00031885m
Physcomitrella patensPp1s61_17V6.4Pp1s61_17V6.5Pp1s61_17V6.3Pp1s61_17V6.2Pp1s61_17V6.1
Phaseolus vulgarisPhvul.007G250500.1
Picea abiesMA_348109g0010
Populus trichocarpaPotri.006G047000.5Potri.006G047000.1Potri.006G047000.2Potri.006G047000.3Potri.006G047000.4
Prunus persicappa009542m
Ricinus communis29840.m000625
Setaria italicaSi001977mSi023477m
Selaginella moellendorffii151094
Sorghum bicolorSb03g045400.1
Thellungiella halophilaThhalv10017045m
Vitis viniferaGSVIVT01033232001
Volvox carteriVocar20000681m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny