y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os02g54420.1
FamilyGT31
Protein PropertiesLength: 308 Molecular Weight: 34332.4 Isoelectric Point: 7.5592
ChromosomeChromosome/Scaffold: 2 Start: 33346334 End: 33347257
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT31722342.4e-29
  ERRALVRLAYALQPAPARAVVHVRFVVCNLTAEEDAALVGLEIAAYGDIIVLDCTENMDNGKTYTYFSAVPRLFAGEPYDYVGKTDDDTYYRLGALADAL
  RDKPRRDAYYGFLTPCHADPRTQYMSGMGYVVSWDVAAWVAATPELQNDLKGPEDKLFGRWLR
Full Sequence
Protein Sequence     Length: 308     Download
MAMKKSFSLL FFLPFLLLAI IYFVIFPNEF RLQSSLAACG DSAPATAADA VAKAAPDIRV    60
LLGVLTRADK YERRALVRLA YALQPAPARA VVHVRFVVCN LTAEEDAALV GLEIAAYGDI    120
IVLDCTENMD NGKTYTYFSA VPRLFAGEPY DYVGKTDDDT YYRLGALADA LRDKPRRDAY    180
YGFLTPCHAD PRTQYMSGMG YVVSWDVAAW VAATPELQND LKGPEDKLFG RWLRWGGRGR    240
NVFGAEPRMY DYLDGGMRHG PTCFRHLLQA DTVAVHKLKD NLKWARTLNF FNATEGHKAS    300
PLFHVDH*                                                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01762Galactosyl_T3.0e-792186103+
Gene Ontology
GO TermDescription
GO:0005623cell
GO:0005975carbohydrate metabolic process
GO:0006464cellular protein modification process
GO:0006486protein glycosylation
GO:0008152metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD19198.103130629308hypothetical protein [Oryza sativa Japonica Group]
DDBJBAD19304.103030630306hypothetical protein [Oryza sativa Japonica Group]
DDBJBAD19307.1013071307hypothetical protein [Oryza sativa Japonica Group]
GenBankEEC70800.102930727305hypothetical protein OsI_02252 [Oryza sativa Indica Group]
RefSeqNP_001136849.102830631324hypothetical protein LOC100217000 [Zea mays]
Transmembrane Domains
StartEnd
726
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV5126442081013060
CT848763187192010
CB619209253563040
EC939282255573050
HX165149239703050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_096_00011.1Aquca_096_00008.1Aquca_096_00010.1Aquca_002_01354.1
Arabidopsis lyrata918927
Arabidopsis thalianaAT5G57500.1
Brachypodium distachyonBradi4g30950.1Bradi3g60170.1Bradi2g15440.1Bradi2g15450.1Bradi2g15460.1
Bradi2g17360.1Bradi4g04430.1Bradi4g16710.1Bradi4g30940.1
Brassica rapaBra002724Bra006816
Carica papayaevm.model.supercontig_52.13
Capsella rubellaCarubv10026744m
Citrus clementinaCiclev10010309m
Citrus sinensisorange1.1g020721m
Cucumis sativusCucsa.092450.1
Eucalyptus grandisEucgr.C00164.1
Fragaria vescamrna04896.1-v1.0-hybridmrna05246.1-v1.0-hybridmrna04895.1-v1.0-hybrid
Glycine maxGlyma13g01060.1Glyma17g07150.1Glyma12g20860.1
Gossypium raimondiiGorai.004G100500.1
Linum usitatissimumLus10015527Lus10000372Lus10006963Lus10000407Lus10019998
Manihot esculentacassava4.1_024374m
Medicago truncatulaMedtr4g128310.1
Mimulus guttatusmgv1a025682mmgv1a018717mmgv1a021117m
Oryza sativaLOC_Os09g26330.1LOC_Os02g54390.1LOC_Os09g26320.1LOC_Os02g54370.1LOC_Os05g47880.1
LOC_Os02g54450.1LOC_Os09g26310.1LOC_Os09g26300.1LOC_Os06g09270.1
Panicum virgatumPavirv00040114mPavirv00020399mPavirv00061634mPavirv00009580mPavirv00040113m
Pavirv00047142mPavirv00009581mPavirv00040592mPavirv00020786mPavirv00027671m
Pavirv00062025mPavirv00047141mPavirv00070843m
Physcomitrella patensPp1s111_120V6.1Pp1s111_120V6.2Pp1s111_120V6.3Pp1s121_91V6.1
Phaseolus vulgarisPhvul.003G146700.1
Picea abiesMA_877072g0010MA_119164g0010MA_118743g0010
Populus trichocarpaPotri.007G131000.1Potri.018G094000.1
Prunus persicappa015950mppa025342mppa022137m
Setaria italicaSi030530mSi019701mSi030596mSi022442mSi019638m
Si008283m
Sorghum bicolorSb09g027700.1Sb04g035240.1Sb02g025430.1Sb10g006180.1Sb04g035250.1
Sb02g025420.1
Thellungiella halophilaThhalv10014129m
Vitis viniferaGSVIVT01038267001GSVIVT01029188001GSVIVT01029189001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)