| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os03g17690.2 |
| Family | AA2 |
| Protein Properties | Length: 192 Molecular Weight: 20761.3 Isoelectric Point: 4.7106 |
| Chromosome | Chromosome/Scaffold: 3 Start: 9843327 End: 9846747 |
| Description | ascorbate peroxidase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 5 | 187 | 0 |
| AELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGH TLGRCHKERSGFEGPWTRNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPLVEKYAADEKAFFEDYKEAHLKLSELG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 192 Download |
| MKTPAELSHA ANAGLDIAVR MLEPIKEEIP TISYADFYQL AGVVAVEVSG GPAVPFHPGR 60 EDKPAPPPEG RLPDATKGSD HLRQVFGAQM GLSDQDIVAL SGGHTLGRCH KERSGFEGPW 120 TRNPLQFDNS YFTELLSGDK EGLLQLPSDK ALLSDPAFRP LVEKYAADEK AFFEDYKEAH 180 LKLSELGFAD A* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00314 | plant_peroxidase_like | 4.0e-48 | 5 | 185 | 207 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| PLN02364 | PLN02364 | 3.0e-105 | 1 | 191 | 191 | + L-ascorbate peroxidase 1 | ||
| PLN02608 | PLN02608 | 1.0e-105 | 1 | 188 | 188 | + L-ascorbate peroxidase | ||
| PLN02879 | PLN02879 | 4.0e-106 | 1 | 190 | 190 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 7.0e-118 | 1 | 191 | 198 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0000003 | reproduction |
| GO:0003824 | catalytic activity |
| GO:0004601 | peroxidase activity |
| GO:0005515 | protein binding |
| GO:0005575 | cellular_component |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| Swiss-Prot | A2XFC7 | 0 | 1 | 191 | 60 | 250 | APX1_ORYSI RecName: Full=L-ascorbate peroxidase 1, cytosolic; Short=APXa; AltName: Full=OsAPx01 |
| EMBL | CAA06996.1 | 0 | 1 | 191 | 60 | 250 | ascorbate peroxidase [Hordeum vulgare subsp. vulgare] |
| RefSeq | NP_001049769.1 | 0 | 1 | 191 | 60 | 250 | Os03g0285700 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001150192.1 | 0 | 1 | 191 | 60 | 250 | APx1 - Cytosolic Ascorbate Peroxidase [Zea mays] |
| RefSeq | XP_002468053.1 | 0 | 1 | 191 | 60 | 250 | hypothetical protein SORBIDRAFT_01g038760 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3zcy_A | 0 | 1 | 191 | 59 | 249 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
| PDB | 2y6a_A | 0 | 1 | 191 | 59 | 249 | A Chain A, Ascorbate Peroxidase R38a Mutant |
| PDB | 3zch_A | 0 | 1 | 191 | 71 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
| PDB | 2wd4_A | 0 | 1 | 191 | 71 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
| PDB | 2vo2_X | 0 | 1 | 191 | 71 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
| L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
| L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| HO188767 | 192 | 1 | 192 | 0 |
| CT846162 | 192 | 1 | 192 | 0 |
| CX109044 | 192 | 1 | 192 | 0 |
| CN012890 | 192 | 1 | 192 | 0 |
| BM444322 | 192 | 1 | 192 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
