y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os03g40330.1
FamilyGH17
Protein PropertiesLength: 216 Molecular Weight: 22849.9 Isoelectric Point: 7.7469
ChromosomeChromosome/Scaffold: 3 Start: 22424025 End: 22424841
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH171342117.3e-29
  IYSAMEKEGGSDVPVVISETGWPSADGRGASKDNARVYNQNLINHVGKGTPKRPVALETYIFAMFDENQKKGDAIERN
GH1711331.4e-36
  MRIYLPNDTILHALRGTRIAVVLDAPDVRSLASNDATNASSSAAQAWVQANVRPYYPDVNIKYIAVGNEVKDGADKPKILPAMNNIRDALSAAGLGGHIK
  VSTAVEMSLVAGSPLPSGSAFADPPSIMGPIVN
Full Sequence
Protein Sequence     Length: 216     Download
MRIYLPNDTI LHALRGTRIA VVLDAPDVRS LASNDATNAS SSAAQAWVQA NVRPYYPDVN    60
IKYIAVGNEV KDGADKPKIL PAMNNIRDAL SAAGLGGHIK VSTAVEMSLV AGSPLPSGSA    120
FADPPSIMGP IVNIYSAMEK EGGSDVPVVI SETGWPSADG RGASKDNARV YNQNLINHVG    180
KGTPKRPVAL ETYIFAMFDE NQKKGDAIER NKFTS*                              240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53092.0e-753203175+
pfam00332Glyco_hydro_173.0e-661211269+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005488binding
GO:0005618cell wall
GO:0005773vacuole
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP12921.1012151218putative beta-1,3-glucanase [Oryza sativa Japonica Group]
GenBankABF97482.1012151215Glycosyl hydrolases family 17 protein [Oryza sativa (japonica cultivar-group)]
DDBJBAH92255.1011691225Os03g0600500 [Oryza sativa Japonica Group]
GenBankEAY90914.10121160307hypothetical protein OsI_12531 [Oryza sativa Indica Group]
RefSeqNP_001050619.1012151271Os03g0600600 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghs_B0121030289A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0121030289A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3ur8_B0121132298A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3ur8_A0121132298A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB3ur7_B0121132298A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CN124833184532110
CJ964835213562115.60519e-45
CJ957912213562119.80909e-45
CJ96002426542119.80909e-45
CJ962565209602112.99878e-43
Orthologous Group
SpeciesID
Carica papayaevm.TU.contig_28309.1evm.TU.contig_29840.1
Citrus sinensisorange1.1g047283morange1.1g039652m.187.254orange1.1g039046morange1.1g039652m.187.254
Fragaria vescamrna21954.1-v1.0-hybrid.155.289mrna21954.1-v1.0-hybrid.155.289
Glycine maxGlyma11g10061.1.99.219Glyma11g10061.1.99.219
Gossypium raimondiiGorai.010G003400.1.154.256Gorai.010G003400.1.154.256
Linum usitatissimumLus10037749Lus10027859Lus10002808
Malus domesticaMDP0000216481MDP0000609149.141.216MDP0000609149.141.216
Manihot esculentacassava4.1_026443m
Medicago truncatulaMedtr2g034440.2.149.229Medtr2g034440.2.149.229
Oryza sativaLOC_Os03g40330.1.134.211LOC_Os03g40330.1.134.211
Picea abiesMA_219456g0010.189.264MA_10426734g0010MA_556757g0010MA_10305466g0010MA_219456g0010.189.264
MA_92691g0010MA_199326g0010
Vitis viniferaGSVIVT01035013001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny