y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os03g47010.1
FamilyCBM22
Protein PropertiesLength: 757 Molecular Weight: 81554.8 Isoelectric Point: 5.2392
ChromosomeChromosome/Scaffold: 3 Start: 26576496 End: 26579282
Descriptionglycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22221611.6e-31
  NIILNPEFDSGLDNWSGSGCKIELHDSLDDGKVLAVSGKYFVAATGRTDTWNGVQQDVTSRLQRKLLYEVAATVRLSGAAATPSPCEVRATVAVQNTDGR
  QQYISVAKSPAVSDKEWVQLQGKFLLNGTVAKAAIYIEGP
CBM221963502.2e-40
  NILQNSDLDDGVNGWFGLGSCALSVHGGAPRVLPPMARQSLSPLDGDDGDGDEPLNGKHIHVTNRAQTWMGPAQVITDRVTPYATYQVSAWVRVGGQQAA
  GKPQNINVAVAVDSQWLNGGQVMALDERWYEIGGSFRVESSSTPPSRVMLYVQGP
GH104116940
  VSNSFPLGACIMRTNMDNEDYVDFFTKHFNWAVFGNELKWYWTEPEKGQLNYADADDLLKLCADHGMCVRGHCIFWEVDSAVQQWVKALPADELSAAVAS
  RINGLLTRYKGKFRHYDVNNEMLHGSFYQDKLGAGARAAMFRAASELDPDALLFVNDYNVEGACVDVRATPEAYIAQVTGLQEQGAAVGGVGLQGHVTAP
  VGAVVRAALDRLAVLGLPLWFTELDVSSANEHVRADDLEAMLREAYAHPAVDGVVLWGFWELSMSRDDAHLVDAEGEVNEAGRR
Full Sequence
Protein Sequence     Length: 757     Download
MAIGGDAGQV VGDGGAGAGD DNIILNPEFD SGLDNWSGSG CKIELHDSLD DGKVLAVSGK    60
YFVAATGRTD TWNGVQQDVT SRLQRKLLYE VAATVRLSGA AATPSPCEVR ATVAVQNTDG    120
RQQYISVAKS PAVSDKEWVQ LQGKFLLNGT VAKAAIYIEG PPAGVDLLLD SLVVKHAQKA    180
TPAPAPDFKN LEYGANILQN SDLDDGVNGW FGLGSCALSV HGGAPRVLPP MARQSLSPLD    240
GDDGDGDEPL NGKHIHVTNR AQTWMGPAQV ITDRVTPYAT YQVSAWVRVG GQQAAGKPQN    300
INVAVAVDSQ WLNGGQVMAL DERWYEIGGS FRVESSSTPP SRVMLYVQGP DPGVDLMVAG    360
LRVFPVDRKA RAKHLRKLTD KVRKRDVVVK VTAAAGGAAA ADGVEVRVRQ VSNSFPLGAC    420
IMRTNMDNED YVDFFTKHFN WAVFGNELKW YWTEPEKGQL NYADADDLLK LCADHGMCVR    480
GHCIFWEVDS AVQQWVKALP ADELSAAVAS RINGLLTRYK GKFRHYDVNN EMLHGSFYQD    540
KLGAGARAAM FRAASELDPD ALLFVNDYNV EGACVDVRAT PEAYIAQVTG LQEQGAAVGG    600
VGLQGHVTAP VGAVVRAALD RLAVLGLPLW FTELDVSSAN EHVRADDLEA MLREAYAHPA    660
VDGVVLWGFW ELSMSRDDAH LVDAEGEVNE AGRRLLQLKR EWLTRAHGRA DGNGEFRFRG    720
HHGAYHVDVV TPAGAKISQE FTVDKDDAPL VLNITV*                             780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_93.0e-11195352166+
COG3693XynA2.0e-14417572165+
pfam02018CBM_4_92.0e-2122163143+
smart00633Glyco_108.0e-49448695269+
pfam00331Glyco_hydro_102.0e-49412699308+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005575cellular_component
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY91350.1017561756hypothetical protein OsI_12971 [Oryza sativa Indica Group]
RefSeqNP_001050876.1017561756Os03g0672900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002301133.10167543291047predicted protein [Populus trichocarpa]
RefSeqXP_002301133.10213631314predicted protein [Populus trichocarpa]
RefSeqXP_002466685.1027563748hypothetical protein SORBIDRAFT_01g012210 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xyz_B4e-3039166913307A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1xyz_A4e-3039166913307A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases
PDB1nq6_A3e-2841766815269A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1tux_A2e-2744666847268A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB3msg_B2e-2741265013258A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EB4427963132235350
CX609126211222320
EL4287552814156950
EB442796118571740.000000009
CX6091261741963630.0000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.2.21.159Aquca_017_00095.2.21.159Aquca_017_00095.2.21.159Aquca_017_00095.1.34.172Aquca_017_00095.1.34.172
Aquca_017_00095.1.34.172Aquca_017_00095.2.194.330Aquca_017_00095.2.194.330Aquca_017_00095.2.194.330Aquca_017_00095.1.207.343
Aquca_017_00095.1.207.343Aquca_017_00095.1.207.343Aquca_017_00095.4.145.286Aquca_017_00095.4.145.286Aquca_017_00095.3.145.286
Aquca_017_00095.3.145.286Aquca_017_00095.2.365.506Aquca_017_00095.2.365.506Aquca_017_00095.2.365.506Aquca_017_00095.1.378.519
Aquca_017_00095.1.378.519Aquca_017_00095.1.378.519
Arabidopsis lyrata471118.183.313471118.183.313471118.183.313471118.183.313475392.29.168
475392.29.168475392.29.168475392.199.334475392.199.334475392.199.334
471118.350.482471118.350.482471118.350.482471118.350.482489729.27.162
489729.27.162489729.197.344489729.197.344475392.369.511475392.369.511
475392.369.511471118.517.661471118.517.661471118.517.661471118.517.661
Arabidopsis thalianaAT1G10050.1.183.313AT1G10050.1.183.313AT1G10050.1.183.313AT1G10050.1.183.313AT1G58370.1.29.168
AT1G58370.1.29.168AT1G58370.1.29.168AT1G58370.1.199.334AT1G58370.1.199.334AT1G58370.1.199.334
AT1G10050.1.350.482AT1G10050.1.350.482AT1G10050.1.350.482AT1G10050.1.350.482AT4G08160.2.27.162
AT4G08160.2.27.162AT4G08160.1.27.162AT4G08160.1.27.162AT4G08160.2.197.344AT4G08160.2.197.344
AT4G08160.1.197.344AT4G08160.1.197.344AT1G58370.1.369.511AT1G58370.1.369.511AT1G58370.1.369.511
AT1G10050.1.517.661AT1G10050.1.517.661AT1G10050.1.517.661AT1G10050.1.517.661
Brachypodium distachyonBradi1g28627.1.218.356Bradi1g28627.1.218.356Bradi1g28627.1.218.356Bradi1g28627.1.218.356Bradi1g12710.1.17.158
Bradi1g12710.1.17.158Bradi1g28627.1.50.187Bradi1g28627.1.50.187Bradi1g28627.1.50.187Bradi1g28627.1.50.187
Bradi1g28627.1.389.522Bradi1g28627.1.389.522Bradi1g28627.1.389.522Bradi1g28627.1.389.522Bradi1g12710.1.193.343
Bradi1g12710.1.193.343Bradi1g28627.1.557.697Bradi1g28627.1.557.697Bradi1g28627.1.557.697Bradi1g28627.1.557.697
Bradi1g27257.1.12.140Bradi2g02320.1.22.183
Brassica rapaBra031698.175.305Bra031698.175.305Bra031698.175.305Bra031698.175.305Bra027867.202.338
Bra027867.202.338Bra027867.202.338Bra027867.30.169Bra027867.30.169Bra027867.30.169
Bra031698.343.475Bra031698.343.475Bra031698.343.475Bra031698.343.475Bra039768.283.376
Bra039768.283.376Bra039768.432.578Bra039768.432.578Bra027867.373.515Bra027867.373.515
Bra027867.373.515Bra031698.510.654Bra031698.510.654Bra031698.510.654Bra031698.510.654
Carica papayaevm.model.supercontig_160.19.30.168evm.model.supercontig_160.19.30.168evm.model.supercontig_160.19.30.168evm.model.supercontig_160.19.203.339evm.model.supercontig_160.19.203.339
evm.model.supercontig_160.19.203.339evm.model.supercontig_160.18.53.191evm.model.supercontig_160.18.53.191evm.model.supercontig_160.18.226.368evm.model.supercontig_160.18.226.368
evm.model.supercontig_160.19.374.515evm.model.supercontig_160.19.374.515evm.model.supercontig_160.19.374.515
Capsella rubellaCarubv10008217m.78.208Carubv10008217m.78.208Carubv10008217m.78.208Carubv10008147m.217.347Carubv10008147m.217.347
Carubv10008147m.217.347Carubv10008147m.217.347Carubv10008147m.39.178Carubv10008147m.39.178Carubv10008147m.39.178
Carubv10008147m.39.178Carubv10019737m.53.192Carubv10019737m.53.192Carubv10019737m.53.192Carubv10019737m.223.358
Carubv10019737m.223.358Carubv10019737m.223.358Carubv10008217m.244.376Carubv10008217m.244.376Carubv10008217m.244.376
Carubv10008147m.384.516Carubv10008147m.384.516Carubv10008147m.384.516Carubv10008147m.384.516Carubv10000293m.27.162
Carubv10000293m.27.162Carubv10019737m.393.535Carubv10019737m.393.535Carubv10019737m.393.535Carubv10000293m.197.346
Carubv10000293m.197.346Carubv10008217m.411.555Carubv10008217m.411.555Carubv10008217m.411.555Carubv10008147m.551.695
Carubv10008147m.551.695Carubv10008147m.551.695Carubv10008147m.551.695
Citrus clementinaCiclev10000171m.69.207Ciclev10000171m.69.207Ciclev10000171m.69.207Ciclev10000171m.242.378Ciclev10000171m.242.378
Ciclev10000171m.242.378Ciclev10000171m.413.554Ciclev10000171m.413.554Ciclev10000171m.413.554
Citrus sinensisorange1.1g002447m.32.170orange1.1g002447m.32.170orange1.1g002447m.32.170orange1.1g002447m.205.341orange1.1g002447m.205.341
orange1.1g002447m.205.341orange1.1g002447m.376.517orange1.1g002447m.376.517orange1.1g002447m.376.517
Cucumis sativusCucsa.143690.1.234.370Cucsa.143690.1.234.370Cucsa.143690.1.234.370Cucsa.353160.7.199.335Cucsa.353160.7.199.335
Cucsa.353160.7.199.335Cucsa.353160.4.232.368Cucsa.353160.4.232.368Cucsa.353160.4.232.368Cucsa.353160.1.232.368
Cucsa.353160.1.232.368Cucsa.353160.1.232.368Cucsa.353160.7.29.167Cucsa.353160.7.29.167Cucsa.353160.7.29.167
Cucsa.353160.4.62.200Cucsa.353160.4.62.200Cucsa.353160.4.62.200Cucsa.353160.1.62.200Cucsa.353160.1.62.200
Cucsa.353160.1.62.200Cucsa.143690.1.63.201Cucsa.143690.1.63.201Cucsa.143690.1.63.201Cucsa.353160.8.145.286
Cucsa.353160.8.145.286Cucsa.353160.7.370.511Cucsa.353160.7.370.511Cucsa.353160.7.370.511Cucsa.353160.4.403.544
Cucsa.353160.4.403.544Cucsa.353160.4.403.544Cucsa.353160.1.403.544Cucsa.353160.1.403.544Cucsa.353160.1.403.544
Cucsa.143690.1.405.546Cucsa.143690.1.405.546Cucsa.143690.1.405.546
Eucalyptus grandisEucgr.F00108.3.174.310Eucgr.F00108.3.174.310Eucgr.F00108.3.174.310Eucgr.F00108.2.213.349Eucgr.F00108.2.213.349
Eucgr.F00108.2.213.349Eucgr.F00108.1.217.353Eucgr.F00108.1.217.353Eucgr.F00108.1.217.353Eucgr.F00108.3.11.139
Eucgr.F00108.3.11.139Eucgr.F00108.3.11.139Eucgr.F00108.2.50.178Eucgr.F00108.2.50.178Eucgr.F00108.2.50.178
Eucgr.F00108.1.54.182Eucgr.F00108.1.54.182Eucgr.F00108.1.54.182Eucgr.F00109.1.167.303Eucgr.F00109.1.167.303
Eucgr.F00109.1.167.303Eucgr.F02205.1.83.218Eucgr.F02205.1.83.218Eucgr.F00109.1.11.132Eucgr.F00109.1.11.132
Eucgr.F00109.1.11.132Eucgr.F02205.1.253.394Eucgr.F02205.1.253.394Eucgr.F00109.1.338.479Eucgr.F00109.1.338.479
Eucgr.F00109.1.338.479Eucgr.F00108.3.345.486Eucgr.F00108.3.345.486Eucgr.F00108.3.345.486Eucgr.F00108.2.384.525
Eucgr.F00108.2.384.525Eucgr.F00108.2.384.525Eucgr.F00108.1.388.529Eucgr.F00108.1.388.529Eucgr.F00108.1.388.529
Fragaria vescamrna02649.1-v1.0-hybrid.56.191mrna02649.1-v1.0-hybrid.56.191mrna02649.1-v1.0-hybrid.56.191mrna02649.1-v1.0-hybrid.224.359mrna02649.1-v1.0-hybrid.224.359
mrna02649.1-v1.0-hybrid.224.359mrna02649.1-v1.0-hybrid.394.535mrna02649.1-v1.0-hybrid.394.535mrna02649.1-v1.0-hybrid.394.535
Glycine maxGlyma14g10456.2.187.323Glyma14g10456.2.187.323Glyma14g10456.2.187.323Glyma14g10456.1.216.352Glyma14g10456.1.216.352
Glyma14g10456.1.216.352Glyma04g05220.3.28.163Glyma04g05220.3.28.163Glyma04g05220.2.28.163Glyma04g05220.2.28.163
Glyma06g05290.1.29.164Glyma06g05290.1.29.164Glyma17g35060.2.216.352Glyma17g35060.2.216.352Glyma17g35060.2.216.352
Glyma17g35060.1.187.323Glyma17g35060.1.187.323Glyma17g35060.1.187.323Glyma17g35060.2.44.182Glyma17g35060.2.44.182
Glyma17g35060.2.44.182Glyma17g35060.1.15.153Glyma17g35060.1.15.153Glyma17g35060.1.15.153Glyma14g10456.2.15.153
Glyma14g10456.2.15.153Glyma14g10456.2.15.153Glyma14g10456.1.44.182Glyma14g10456.1.44.182Glyma14g10456.1.44.182
Glyma06g05290.1.199.340Glyma06g05290.1.199.340Glyma04g05220.3.198.339Glyma04g05220.3.198.339Glyma04g05220.2.198.339
Glyma04g05220.2.198.339Glyma14g10456.2.358.499Glyma14g10456.2.358.499Glyma14g10456.2.358.499Glyma14g10456.1.387.528
Glyma14g10456.1.387.528Glyma14g10456.1.387.528Glyma17g35060.2.387.529Glyma17g35060.2.387.529Glyma17g35060.2.387.529
Glyma17g35060.1.358.500Glyma17g35060.1.358.500Glyma17g35060.1.358.500
Gossypium raimondiiGorai.009G223500.7.198.333Gorai.009G223500.7.198.333Gorai.009G223500.7.198.333Gorai.009G223500.6.58.193Gorai.009G223500.6.58.193
Gorai.009G223500.5.198.333Gorai.009G223500.5.198.333Gorai.009G223500.5.198.333Gorai.009G223500.4.197.332Gorai.009G223500.4.197.332
Gorai.009G223500.4.197.332Gorai.009G223500.3.198.333Gorai.009G223500.3.198.333Gorai.009G223500.3.198.333Gorai.009G223500.2.197.332
Gorai.009G223500.2.197.332Gorai.009G223500.2.197.332Gorai.009G223500.1.198.333Gorai.009G223500.1.198.333Gorai.009G223500.1.198.333
Gorai.009G223600.1.51.187Gorai.009G223600.1.51.187Gorai.010G029100.1.217.353Gorai.010G029100.1.217.353Gorai.010G029100.1.217.353
Gorai.009G223500.7.24.162Gorai.009G223500.7.24.162Gorai.009G223500.7.24.162Gorai.009G223500.5.24.162Gorai.009G223500.5.24.162
Gorai.009G223500.5.24.162Gorai.009G223500.4.24.162Gorai.009G223500.4.24.162Gorai.009G223500.4.24.162Gorai.009G223500.3.24.162
Gorai.009G223500.3.24.162Gorai.009G223500.3.24.162Gorai.009G223500.2.24.162Gorai.009G223500.2.24.162Gorai.009G223500.2.24.162
Gorai.009G223500.1.24.162Gorai.009G223500.1.24.162Gorai.009G223500.1.24.162Gorai.010G029100.1.45.185Gorai.010G029100.1.45.185
Gorai.010G029100.1.45.185Gorai.009G223500.7.368.509Gorai.009G223500.7.368.509Gorai.009G223500.7.368.509Gorai.009G223500.6.228.369
Gorai.009G223500.6.228.369Gorai.009G223500.5.368.509Gorai.009G223500.5.368.509Gorai.009G223500.5.368.509Gorai.009G223500.4.367.508
Gorai.009G223500.4.367.508Gorai.009G223500.4.367.508Gorai.009G223500.3.368.509Gorai.009G223500.3.368.509Gorai.009G223500.3.368.509
Gorai.009G223500.2.367.508Gorai.009G223500.2.367.508Gorai.009G223500.2.367.508Gorai.009G223500.1.368.509Gorai.009G223500.1.368.509
Gorai.009G223500.1.368.509Gorai.010G029100.1.388.529Gorai.010G029100.1.388.529Gorai.010G029100.1.388.529Gorai.009G223600.1.222.363
Gorai.009G223600.1.222.363
Linum usitatissimumLus10028243.416.553Lus10028243.416.553Lus10028243.416.553Lus10028243.416.553Lus10007243.417.554
Lus10007243.417.554Lus10007243.417.554Lus10007243.417.554Lus10011465.507.643Lus10011465.507.643
Lus10011465.507.643Lus10011465.507.643Lus10037528.728.864Lus10037528.728.864Lus10037528.728.864
Lus10037528.728.864Lus10037528.728.864Lus10037528.469.605Lus10037528.469.605Lus10037528.469.605
Lus10037528.469.605Lus10037528.469.605Lus10011465.332.469Lus10011465.332.469Lus10011465.332.469
Lus10011465.332.469Lus10007243.245.385Lus10007243.245.385Lus10007243.245.385Lus10007243.245.385
Lus10028243.74.211Lus10028243.74.211Lus10028243.74.211Lus10028243.74.211Lus10037528.294.431
Lus10037528.294.431Lus10037528.294.431Lus10037528.294.431Lus10037528.294.431Lus10037528.120.257
Lus10037528.120.257Lus10037528.120.257Lus10037528.120.257Lus10037528.120.257Lus10007243.75.211
Lus10007243.75.211Lus10007243.75.211Lus10007243.75.211Lus10011465.168.305Lus10011465.168.305
Lus10011465.168.305Lus10011465.168.305Lus10028243.245.384Lus10028243.245.384Lus10028243.245.384
Lus10028243.245.384Lus10007242.62.198Lus10007242.62.198Lus10028242.61.197Lus10028242.61.197
Lus10028243.588.731Lus10028243.588.731Lus10028243.588.731Lus10028243.588.731Lus10007243.589.732
Lus10007243.589.732Lus10007243.589.732Lus10007243.589.732Lus10011465.677.819Lus10011465.677.819
Lus10011465.677.819Lus10011465.677.819Lus10028242.232.374Lus10028242.232.374Lus10007242.233.375
Lus10007242.233.375
Malus domesticaMDP0000212739.64.190MDP0000212739.64.190MDP0000212739.64.190MDP0000212739.64.190MDP0000146624.64.190
MDP0000146624.64.190MDP0000146624.64.190MDP0000225641.62.188MDP0000225641.62.188MDP0000225641.62.188
MDP0000212739.225.359MDP0000212739.225.359MDP0000212739.225.359MDP0000212739.225.359MDP0000146624.300.436
MDP0000146624.300.436MDP0000146624.300.436MDP0000212739.394.530MDP0000212739.394.530MDP0000212739.394.530
MDP0000212739.394.530MDP0000225641.223.369MDP0000225641.223.369MDP0000225641.223.369MDP0000225641.404.545
MDP0000225641.404.545MDP0000225641.404.545MDP0000212739.565.706MDP0000212739.565.706MDP0000212739.565.706
MDP0000212739.565.706MDP0000146624.471.612MDP0000146624.471.612MDP0000146624.471.612
Manihot esculentacassava4.1_001252m.30.167cassava4.1_001252m.30.167cassava4.1_001252m.30.167cassava4.1_001252m.204.340cassava4.1_001252m.204.340
cassava4.1_001252m.204.340cassava4.1_001250m.204.340cassava4.1_001250m.204.340cassava4.1_001250m.204.340cassava4.1_001320m.32.169
cassava4.1_001320m.32.169cassava4.1_001320m.32.169cassava4.1_001250m.30.167cassava4.1_001250m.30.167cassava4.1_001250m.30.167
cassava4.1_002200m.47.182cassava4.1_002200m.47.182cassava4.1_001320m.190.326cassava4.1_001320m.190.326cassava4.1_001320m.190.326
cassava4.1_001252m.375.516cassava4.1_001252m.375.516cassava4.1_001252m.375.516cassava4.1_001250m.375.516cassava4.1_001250m.375.516
cassava4.1_001250m.375.516cassava4.1_002200m.217.358cassava4.1_002200m.217.358cassava4.1_001320m.361.502cassava4.1_001320m.361.502
cassava4.1_001320m.361.502
Mimulus guttatusmgv1a000981m.208.344mgv1a000981m.208.344mgv1a000981m.208.344mgv1a027071m.14.153mgv1a027071m.14.153
mgv1a027071m.14.153mgv1a027071m.177.313mgv1a027071m.177.313mgv1a027071m.177.313mgv1a000981m.32.171
mgv1a000981m.32.171mgv1a000981m.32.171mgv1a027071m.348.489mgv1a027071m.348.489mgv1a027071m.348.489
mgv1a000981m.379.519mgv1a000981m.379.519mgv1a000981m.379.519
Oryza sativaLOC_Os03g47010.1.22.161LOC_Os03g47010.1.22.161LOC_Os07g27320.1.220.358LOC_Os07g27320.1.220.358LOC_Os07g27320.1.220.358
LOC_Os07g27320.1.220.358LOC_Os07g27320.1.51.189LOC_Os07g27320.1.51.189LOC_Os07g27320.1.51.189LOC_Os07g27320.1.51.189
LOC_Os07g27320.1.391.524LOC_Os07g27320.1.391.524LOC_Os07g27320.1.391.524LOC_Os07g27320.1.391.524LOC_Os07g27320.1.559.699
LOC_Os07g27320.1.559.699LOC_Os07g27320.1.559.699LOC_Os07g27320.1.559.699LOC_Os03g47010.1.196.350LOC_Os03g47010.1.196.350
LOC_Os01g04300.1.12.156
Panicum virgatumPavirv00018091m.24.162Pavirv00018091m.24.162Pavirv00070694m.15.153Pavirv00070694m.15.153Pavirv00070694m.15.153
Pavirv00070694m.15.153Pavirv00010604m.49.187Pavirv00010604m.49.187Pavirv00010604m.49.187Pavirv00010604m.49.187
Pavirv00010604m.219.356Pavirv00010604m.219.356Pavirv00010604m.219.356Pavirv00010604m.219.356Pavirv00043679m.17.159
Pavirv00043679m.17.159Pavirv00070694m.185.322Pavirv00070694m.185.322Pavirv00070694m.185.322Pavirv00070694m.185.322
Pavirv00010604m.389.522Pavirv00010604m.389.522Pavirv00010604m.389.522Pavirv00010604m.389.522Pavirv00070694m.355.488
Pavirv00070694m.355.488Pavirv00070694m.355.488Pavirv00070694m.355.488Pavirv00018091m.197.343Pavirv00018091m.197.343
Pavirv00043679m.194.339Pavirv00043679m.194.339Pavirv00070694m.523.663Pavirv00070694m.523.663Pavirv00070694m.523.663
Pavirv00070694m.523.663Pavirv00010604m.557.697Pavirv00010604m.557.697Pavirv00010604m.557.697Pavirv00010604m.557.697
Pavirv00009472m.20.173
Physcomitrella patensPp1s299_60V6.1.177.313Pp1s299_60V6.1.177.313Pp1s299_60V6.1.177.313Pp1s299_60V6.1.177.313Pp1s121_107V6.1.167.303
Pp1s121_107V6.1.167.303Pp1s121_107V6.1.167.303Pp1s299_60V6.1.357.491Pp1s299_60V6.1.357.491Pp1s299_60V6.1.357.491
Pp1s299_60V6.1.357.491Pp1s121_107V6.1.515.657Pp1s121_107V6.1.515.657Pp1s121_107V6.1.515.657Pp1s299_60V6.1.526.668
Pp1s299_60V6.1.526.668Pp1s299_60V6.1.526.668Pp1s299_60V6.1.526.668
Phaseolus vulgarisPhvul.001G032300.2.187.323Phvul.001G032300.2.187.323Phvul.001G032300.2.187.323Phvul.001G032300.1.214.350Phvul.001G032300.1.214.350
Phvul.001G032300.1.214.350Phvul.009G075400.1.29.164Phvul.009G075400.1.29.164Phvul.001G032300.2.15.153Phvul.001G032300.2.15.153
Phvul.001G032300.2.15.153Phvul.001G032300.1.42.180Phvul.001G032300.1.42.180Phvul.001G032300.1.42.180Phvul.001G032400.1
Phvul.001G032300.2.358.499Phvul.001G032300.2.358.499Phvul.001G032300.2.358.499Phvul.001G032300.1.385.526Phvul.001G032300.1.385.526
Phvul.001G032300.1.385.526Phvul.009G075400.1.199.340Phvul.009G075400.1.199.340
Picea abiesMA_287044g0010.210.344MA_287044g0010.210.344MA_287044g0010.26.160MA_287044g0010.26.160MA_44877g0010
MA_10432071g0010
Populus trichocarpaPotri.002G113100.1.375.511Potri.002G113100.1.375.511Potri.002G113100.1.375.511Potri.002G113100.1.375.511Potri.002G113100.1.204.341
Potri.002G113100.1.204.341Potri.002G113100.1.204.341Potri.002G113100.1.204.341Potri.002G113100.2.42.178Potri.002G113100.2.42.178
Potri.002G113100.1.42.177Potri.002G113100.1.42.177Potri.002G113100.1.42.177Potri.002G113100.1.42.177Potri.002G113100.1.546.687
Potri.002G113100.1.546.687Potri.002G113100.1.546.687Potri.002G113100.1.546.687Potri.002G113100.2.213.354Potri.002G113100.2.213.354
Prunus persicappa001089m.198.334ppa001089m.198.334ppa001089m.198.334ppa001089m.27.163ppa001089m.27.163
ppa001089m.27.163ppa001089m.369.510ppa001089m.369.510ppa001089m.369.510
Ricinus communis30170.m013645.19.15630170.m013645.19.15630170.m013645.19.15630170.m013645.186.32230170.m013645.186.322
30170.m013645.186.32230170.m013644.113.24930170.m013644.113.24930170.m013644.284.42530170.m013644.284.425
30170.m013645.357.49830170.m013645.357.49830170.m013645.357.498
Setaria italicaSi038956m.20.160Si038956m.20.160Si028759m.49.186Si028759m.49.186Si028759m.49.186
Si028759m.49.186Si028759m.389.522Si028759m.389.522Si028759m.389.522Si028759m.389.522
Si028759m.218.356Si028759m.218.356Si028759m.218.356Si028759m.218.356Si038956m.195.341
Si038956m.195.341Si028759m.557.697Si028759m.557.697Si028759m.557.697Si028759m.557.697
Si000630m.92.241Si034995m.10.155
Selaginella moellendorffii111304.171.301111304.171.301111304.171.301111304.336.477111304.336.477
111304.336.477
Sorghum bicolorSb01g012210.1.24.162Sb01g012210.1.24.162Sb02g010990.1.216.354Sb02g010990.1.216.354Sb02g010990.1.216.354
Sb02g010990.1.216.354Sb02g010990.1.49.186Sb02g010990.1.49.186Sb02g010990.1.49.186Sb02g010990.1.49.186
Sb02g010990.1.387.520Sb02g010990.1.387.520Sb02g010990.1.387.520Sb02g010990.1.387.520Sb01g012210.1.197.339
Sb01g012210.1.197.339Sb02g010990.1.555.696Sb02g010990.1.555.696Sb02g010990.1.555.696Sb02g010990.1.555.696
Sb03g006950.1.12.161Sb03g006980.1.28.186
Thellungiella halophilaThhalv10006640m.182.312Thhalv10006640m.182.312Thhalv10006640m.182.312Thhalv10006640m.182.312Thhalv10023244m.210.346
Thhalv10023244m.210.346Thhalv10023244m.210.346Thhalv10023244m.42.181Thhalv10023244m.42.181Thhalv10023244m.42.181
Thhalv10006640m.349.481Thhalv10006640m.349.481Thhalv10006640m.349.481Thhalv10006640m.349.481Thhalv10028466m.27.162
Thhalv10028466m.27.162Thhalv10023244m.381.523Thhalv10023244m.381.523Thhalv10023244m.381.523Thhalv10006640m.516.660
Thhalv10006640m.516.660Thhalv10006640m.516.660Thhalv10006640m.516.660Thhalv10028466m.197.330Thhalv10028466m.197.330
Vitis viniferaGSVIVT01009272001.233.369GSVIVT01009272001.233.369GSVIVT01009272001.233.369GSVIVT01009272001.60.198GSVIVT01009272001.60.198
GSVIVT01009272001.60.198GSVIVT01009272001.404.545GSVIVT01009272001.404.545GSVIVT01009272001.404.545
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)