y
Basic Information | |
---|---|
Species | Oryza sativa |
Cazyme ID | LOC_Os03g60700.2 |
Family | GT2 |
Protein Properties | Length: 245 Molecular Weight: 27065.6 Isoelectric Point: 8.0165 |
Chromosome | Chromosome/Scaffold: 3 Start: 34498153 End: 34501293 |
Description | Nucleotide-diphospho-sugar transferases superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT2 | 115 | 223 | 4.9e-32 |
SLIIPAYNEEHRLPEALTETLNYLKQRSAVEKSFTYEVLIVDDGSTDHTSKVAFEFVRKHKIDNVRVLLLGRNHGKGEAVRKGMLHSRGELLLMLDADGA TKVTDLEKL |
Full Sequence |
---|
Protein Sequence Length: 245 Download |
MAAAGWPLSS SVADLLPASL SLTLLLASLV HPLPPSAPFL LRLLALLIPS PRPSRAQVVV 60 VVLAAAAFFF EHIRKIGCTH SLERTEVSAA FFEDPNSLNK VRCPSIYDPA EKYISLIIPA 120 YNEEHRLPEA LTETLNYLKQ RSAVEKSFTY EVLIVDDGST DHTSKVAFEF VRKHKIDNVR 180 VLLLGRNHGK GEAVRKGMLH SRGELLLMLD ADGATKVTDL EKLEAQVCHK LNQNMFYKVL 240 LCIL* 300 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00761 | Glyco_tranf_GTA_type | 7.0e-19 | 117 | 238 | 130 | + Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities. | ||
pfam00535 | Glycos_transf_2 | 6.0e-23 | 115 | 223 | 109 | + Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids. | ||
cd04179 | DPM_DPG-synthase_like | 9.0e-32 | 116 | 227 | 112 | + DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
PTZ00260 | PTZ00260 | 4.0e-41 | 106 | 234 | 131 | + dolichyl-phosphate beta-glucosyltransferase; Provisional | ||
cd04188 | DPG_synthase | 1.0e-46 | 116 | 227 | 112 | + DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005783 | endoplasmic reticulum |
GO:0005975 | carbohydrate metabolic process |
GO:0006464 | cellular protein modification process |
GO:0009058 | biosynthetic process |
GO:0016740 | transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAO18453.1 | 0 | 1 | 227 | 1 | 227 | putative dolichyl-phosphate beta-glucosyltransferase [Oryza sativa Japonica Group] |
GenBank | AAO65871.1 | 0 | 1 | 244 | 1 | 244 | putative dolichyl-phosphate beta-glucosyltransferase [Oryza sativa Japonica Group] |
GenBank | ABF99599.1 | 0 | 1 | 244 | 1 | 216 | glycosyl transferase, group 2 family protein, expressed [Oryza sativa (japonica cultivar-group)] |
GenBank | EEC76428.1 | 0 | 72 | 227 | 44 | 199 | hypothetical protein OsI_14108 [Oryza sativa Indica Group] |
RefSeq | NP_001051729.1 | 0 | 72 | 227 | 44 | 199 | Os03g0821800 [Oryza sativa (japonica cultivar-group)] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3e26_A | 0.001 | 110 | 212 | 41 | 136 | A Chain A, Crystal Structure Of Glucosyl-3-Phosphoglycerate Synthase From Mycobacterium Tuberculosis |
PDB | 3e25_A | 0.001 | 110 | 212 | 41 | 136 | A Chain A, Crystal Structure Of M. Tuberculosis Glucosyl-3- Phosphoglycerate Synthase |
PDB | 4dec_A | 0.001 | 110 | 212 | 61 | 156 | A Chain A, Crystal Structure Of M. Tuberculosis Glucosyl-3- Phosphoglycerate Synthase |
PDB | 4de7_A | 0.001 | 110 | 212 | 61 | 156 | A Chain A, Crystal Structure Of M. Tuberculosis Glucosyl-3- Phosphoglycerate Synthase |
PDB | 4ddz_A | 0.001 | 110 | 212 | 61 | 156 | A Chain A, Crystal Structure Of Glucosyl-3-Phosphoglycerate Synthase From Mycobacterium Tuberculosis |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
dolichyl-diphosphooligosaccharide biosynthesis | 2.4.1.117-RXN | EC-2.4.1.117 | dolichyl-phosphate β-glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CB656726 | 157 | 71 | 227 | 0 |
FE617233 | 165 | 71 | 235 | 0 |
CA235044 | 157 | 71 | 227 | 0 |
DR971949 | 157 | 71 | 227 | 0 |
EB403410 | 157 | 71 | 227 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |