CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os04g43360.2
FamilyGH1
Protein PropertiesLength: 427 Molecular Weight: 48855.5 Isoelectric Point: 9.06
ChromosomeChromosome/Scaffold: 4 Start: 25640270 End: 25644607
Descriptionbeta-glucosidase 45
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH114050
  MHSLGVNSYRFSISWARILPKGRFGDVNPDGVAFYNALIDGLVQKGIQPFVTICHYDIPHELDERYGGWLSPEIQKDFSYFAEVCFKLFGDRIKFWTTFN
  QPNLSIKFSYMDGFYSPGRCSEPFGKCALGNSSIEPYVAGHNIILSHANAVSVYRNKYQGKQGGQIGIALSITWYEPFRNTTIDLLAVKRALSFGASWFL
  DPILLGDYPTEMREVLGQSLPKFTSKQKNRLQSTKLDFIGLNHYTTCYVKDCIFSPCEIDPVNADARVFSLYERDGVPIGKATGAPFFHDVPRGMEEAVT
  YYKQRYNNTPTYITENGYSQASNSNMTAKDFTNDTGRITYIQGYLISLASAIRKGADVRGYFVWSLLDDFEWNFGYTLRFGLYHVHYKTLKRTPKLSVDW
  YRKFL
Full Sequence
Protein Sequence     Length: 427     Download
MHSLGVNSYR FSISWARILP KGRFGDVNPD GVAFYNALID GLVQKGIQPF VTICHYDIPH    60
ELDERYGGWL SPEIQKDFSY FAEVCFKLFG DRIKFWTTFN QPNLSIKFSY MDGFYSPGRC    120
SEPFGKCALG NSSIEPYVAG HNIILSHANA VSVYRNKYQG KQGGQIGIAL SITWYEPFRN    180
TTIDLLAVKR ALSFGASWFL DPILLGDYPT EMREVLGQSL PKFTSKQKNR LQSTKLDFIG    240
LNHYTTCYVK DCIFSPCEID PVNADARVFS LYERDGVPIG KATGAPFFHD VPRGMEEAVT    300
YYKQRYNNTP TYITENGYSQ ASNSNMTAKD FTNDTGRITY IQGYLISLAS AIRKGADVRG    360
YFVWSLLDDF EWNFGYTLRF GLYHVHYKTL KRTPKLSVDW YRKFLTGSLL RRKFRDESQL    420
HKFNSY* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029984.0e-1051409413+
PLN02849PLN028491.0e-1051407409+
PLN02814PLN028143.0e-1081420434+
TIGR03356BGL4.0e-1131401401+
pfam00232Glyco_hydro_16.0e-1141407416+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005488binding
GO:0005623cell
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ31330.101426178566hypothetical protein OsJ_15447 [Oryza sativa Japonica Group]
RefSeqNP_001053302.10142691516Os04g0513100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002448169.10142188507hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
RefSeqXP_002448173.10141391504hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
RefSeqXP_002448174.10141192504hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A0140579486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gnp_A0140579486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gno_A0140579486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B0140597503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A0140597503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC365907268923590
GO8883082521744250
GR360278234693020
HO77773940414040
GR3602782445680.0002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43390.1LOC_Os04g43400.1
LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)