y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os04g52600.1
FamilyCBM57
Protein PropertiesLength: 1026 Molecular Weight: 111603 Isoelectric Point: 7.4389
ChromosomeChromosome/Scaffold: 4 Start: 31274470 End: 31282411
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM574275992.4e-27
  FAVDCGSNRLISASDNLRYQTDDASLGPASYSVTGAPTWGVSNVGKFVDAPNGSYIIYSSRQFQNTLDSELFQTSRMSPSSLRYYGIGLENGNYTVTLQF
  AEFGIEDTQTWKSLGRRVFDIYLQGERQEKNFDIRKAAGDKSYTVVKKSYKVPVTKNFLEIHLFWAGKGTCCI
Full Sequence
Protein Sequence     Length: 1026     Download
MRVMSHLLLH GGVLLLLLAA AAVQAQRVAT KTDPTEAAAL NAVFAKLGQQ ASLSTATWNI    60
SGDPCTGAAT DGTPIDDNPN FNPAIKCDCT FQNNTVCRIT KLKIYALDVP GTIPQELRNL    120
TRLTHLNLGQ NTLTGPLPSF IGELTNMQNM TFRINSLSGP IPKELGNLTN LVSLGLGSNR    180
FNGSLPSELG NLDKLQELYI DSAGLSGPLP SSFSKLTRMQ TLWASDNDFT GQIPDYIGNW    240
NLTDLRFQGN SFQGPIPSAL SNLVQLSSLR IGDIENGSSS SLAFIGNMTS LSILILRNCK    300
ISDNLASIDF SKFASLNLLD LSFNNITGQV PTALLGLNLL NSLFLGNNSL SGSLPSSKGP    360
SLSTLDFSYN QLSGNFPPWA SGKNLQLNLV ANNFVIDSSN NSILPSGLAC LQRNTPCFLG    420
SPQSSSFAVD CGSNRLISAS DNLRYQTDDA SLGPASYSVT GAPTWGVSNV GKFVDAPNGS    480
YIIYSSRQFQ NTLDSELFQT SRMSPSSLRY YGIGLENGNY TVTLQFAEFG IEDTQTWKSL    540
GRRVFDIYLQ GERQEKNFDI RKAAGDKSYT VVKKSYKVPV TKNFLEIHLF WAGKGTCCIP    600
GQGYYGPTIS ALSVTPADFT PTVGIVAEQN KSTSKTGVIV GVVVGVAVLG LVALVGIFMW    660
RQKRRKLTLE QQELYSIVGR PNVFSYSELR SATENFSSSN RLGEGGYGAV YKGKLNDGRV    720
VAVKQLSQTS HQGKKQFATE IETISRVQHR NLVKLYGCCL EGNNPLLVYE YMENGSLDKA    780
LFGIEKLNID WPARFDICLG IARGLAYLHE ESSIRVVHRD IKASNVLLDA NLNPKISDFG    840
LAKLYDDKKT HVSTKVAGTF GYLAPEYAMR GHMTEKVDVF AFGVVLLETL AGRPNYDDTL    900
EEDKIYIFEW AWELYENNNP LGIVDPNLRE FNRAEVLRAI HVALLCTQGS PHQRPPMSRV    960
VSMLTGDTEV TDVLMKPSYI TEWQIKGGNT SFANSAVRGQ SSSAPGSTSQ QASSVFLNSI    1020
IQEGR*                                                               1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00192PTKc5.0e-53700965290+
cd00180PKc5.0e-55702888191+
pfam00069Pkinase2.0e-55701909213+
smart00221STYKc1.0e-56702964279+
smart00219TyrKc1.0e-56702964279+
Gene Ontology
GO TermDescription
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005886plasma membrane
GO:0006464cellular protein modification process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAD41882.201102511025OSJNBa0093O08.1 [Oryza sativa (japonica cultivar-group)]
EMBLCAD41884.2029844987OSJNBa0093O08.3 [Oryza sativa (japonica cultivar-group)]
EMBLCAJ86313.1027102526917H0525G02.10 [Oryza sativa (indica cultivar-group)]
GenBankEAY95562.1027102526917hypothetical protein OsI_17410 [Oryza sativa Indica Group]
GenBankEEE61686.101102511001hypothetical protein OsJ_16159 [Oryza sativa Japonica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ulz_A067896714309A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB3uim_A067896714309A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation
PDB3tl8_H067896722317B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_G067896722317B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_D067896722317B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Transmembrane Domains
StartEnd
724
636658
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6573272726629330
CB6770992626629230
CB6574242727109810
CB6579712746108830
GT04894630370510060
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00368.2Aquca_030_00368.1
Arabidopsis lyrata883240.424.594883240.424.594892639892640892638
Arabidopsis thalianaAT1G56130.1AT1G56140.1AT1G56120.1AT1G56145.2AT1G56145.1
Brachypodium distachyonBradi5g21870.2Bradi5g21857.1Bradi3g17756.2Bradi3g17756.1Bradi1g48230.1
Brassica rapaBra003333Bra007909Bra007908Bra030813Bra030815
Bra033670Bra035966Bra033958Bra007907Bra016226
Carica papayaevm.model.supercontig_2207.1evm.model.supercontig_748.4
Capsella rubellaCarubv10008172mCarubv10012587mCarubv10010895mCarubv10008256mCarubv10008071m.409.563
Carubv10008071m.409.563Carubv10008183m
Citrus clementinaCiclev10007054mCiclev10007687mCiclev10007686mCiclev10018029mCiclev10018038m
Ciclev10014641mCiclev10014117m
Citrus sinensisorange1.1g001658morange1.1g008072morange1.1g006515morange1.1g006206morange1.1g004413m
orange1.1g002562morange1.1g002581morange1.1g038019m
Cucumis sativusCucsa.239700.2Cucsa.239700.1
Eucalyptus grandisEucgr.F04434.2Eucgr.F04434.1Eucgr.F04306.1Eucgr.F04441.1Eucgr.F02391.1
Eucgr.F04436.1Eucgr.C02767.1Eucgr.L01594.1Eucgr.F04301.1Eucgr.L01787.1
Eucgr.B01468.1Eucgr.F04437.1
Fragaria vescamrna11624.1-v1.0-hybridmrna16334.1-v1.0-hybridmrna30033.1-v1.0-hybridmrna28048.1-v1.0-hybrid
Glycine maxGlyma09g15200.3Glyma09g15200.2Glyma09g15200.1Glyma08g25590.2Glyma08g25600.2
Glyma08g25600.1
Gossypium raimondiiGorai.002G105800.1Gorai.001G034000.1Gorai.011G052100.1Gorai.N011200.1Gorai.011G052400.2
Gorai.011G052400.1Gorai.001G131900.1Gorai.006G091400.1Gorai.011G052300.5Gorai.011G052300.4
Gorai.011G052300.3Gorai.011G052300.2Gorai.011G052300.1Gorai.011G052000.1Gorai.011G052600.8
Gorai.011G052600.7Gorai.011G052600.6Gorai.011G052600.5Gorai.011G052600.4Gorai.011G052600.3
Gorai.011G052600.2Gorai.011G052600.1
Linum usitatissimumLus10031199
Malus domesticaMDP0000210289MDP0000183693.203.372MDP0000183693.203.372MDP0000213902MDP0000251746
MDP0000269684MDP0000267728MDP0000281046MDP0000207688MDP0000183693.772.939
MDP0000183693.772.939MDP0000389758MDP0000278907MDP0000306337MDP0000384033
MDP0000171164MDP0000307776MDP0000212717MDP0000311945MDP0000308237
MDP0000283397MDP0000122720
Manihot esculentacassava4.1_001509mcassava4.1_001407mcassava4.1_025733mcassava4.1_030674m
Mimulus guttatusmgv1a002601mmgv1a018669mmgv1a000612m
Oryza sativaLOC_Os04g22470.1LOC_Os08g10300.1LOC_Os08g10290.1LOC_Os04g52640.3LOC_Os04g52640.2
LOC_Os04g52640.1LOC_Os04g52630.1LOC_Os05g17810.1LOC_Os04g52614.1LOC_Os08g10330.1
LOC_Os05g17604.6LOC_Os05g17604.5LOC_Os05g17604.4LOC_Os05g17604.3LOC_Os05g17604.2
LOC_Os05g17604.1LOC_Os05g16430.1LOC_Os08g10320.3LOC_Os08g10320.2LOC_Os08g10320.1
LOC_Os08g10310.3LOC_Os08g10310.2LOC_Os08g10310.1LOC_Os04g52606.1LOC_Os05g16930.1
LOC_Os06g07130.1LOC_Os04g52590.1LOC_Os08g10250.1LOC_Os05g16824.4LOC_Os05g16824.3
LOC_Os05g16824.2LOC_Os05g16824.1LOC_Os05g16740.1
Panicum virgatumPavirv00010367mPavirv00021132mPavirv00063388mPavirv00039446mPavirv00006527m
Pavirv00041471mPavirv00039639mPavirv00031150mPavirv00014784mPavirv00036213m
Pavirv00070332mPavirv00032467mPavirv00022623mPavirv00048042m
Physcomitrella patensPp1s244_27V6.2
Phaseolus vulgarisPhvul.011G169300.1
Picea abiesMA_170647g0010MA_162469g0010MA_73800g0010MA_8849269g0010MA_18275g0010
MA_17053g0010MA_954053g0010MA_54077g0010MA_10436782g0010MA_404302g0010
MA_461914g0010
Populus trichocarpaPotri.006G255100.2Potri.018G026800.2Potri.018G026800.1Potri.006G255100.1Potri.001G082900.5
Potri.001G082900.4Potri.001G082900.3Potri.001G082900.2Potri.001G082900.1Potri.003G148000.3
Potri.003G148000.2Potri.003G148000.1Potri.007G067900.3Potri.007G067900.2Potri.007G067900.1
Prunus persicappa017326mppa017049mppa001211mppa001152mppa000802m
ppa015982mppa026535m
Ricinus communis29848.m00461730169.m00632829497.m00008929624.m000325
Setaria italicaSi013203mSi013191mSi013178mSi009240mSi012655m
Si009468mSi009463mSi009322mSi028769mSi028790m
Si009325mSi009466mSi009259mSi006097m
Selaginella moellendorffii438852
Sorghum bicolorSb07g005820.1Sb06g028570.1Sb06g028560.1Sb10g004730.1
Thellungiella halophilaThhalv10012006mThhalv10018064mThhalv10011215mThhalv10016280mThhalv10016175m
Thhalv10019658mThhalv10012222m
Vitis viniferaGSVIVT01037993001.434.602GSVIVT01037993001.434.602GSVIVT01035865001GSVIVT01013621001GSVIVT01029720001.503.674
GSVIVT01029720001.503.674GSVIVT01037982001GSVIVT01038011001GSVIVT01013608001GSVIVT01013612001
GSVIVT01029718001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)