CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os04g53310.1
FamilyCBM53
Protein PropertiesLength: 1217 Molecular Weight: 138205 Isoelectric Point: 5.3423
ChromosomeChromosome/Scaffold: 4 Start: 31750955 End: 31759581
Descriptionstarch synthase 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM533344173e-33
  SVIDLYLNHSMSALASEPDILIKGAFNGWRWKKFTQKMHKSELTGDWWCCKLHIPKQAYRLDFVFFNGDTIYENNNHNDFVLQI
CBM536707583.6e-35
  GTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHLRATVRVPLDAYMMDFVFSESEEGGIYDNRNGMDYHSPV
CBM535085981.4e-35
  GDRVKLFYNRSSRPLMHNTEIWMHGGYNNWSDGLSIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVV
GT576912110
  HIVHIAVEMAPIAKVGGLGDVVTSLSRAVQDLGHNVEVILPKYDCLNLSNVKDLHYRQSFTWGNTEIKVWFGKVEDVPVYFLEPQNGMFWVGCVYGRNDE
  SRFGFFCHSALEFLRQNGSSPDIIHCHDWSSAPVAWLFKEQYAQNGLSNGRVVFTIHNLEFGAHHIGKAMARCDKATTVSYTYSREVSGHGAIAPHFSKF
  HGIRNGIDPDIWDPYSDNFIPVHYTSENVVEGKSAAKKALQQRLGLQQTDTPVVGIISRLTVQKGIHLIKHAIYRTLERNGQVVLLGSAPDHRIQGDFTN
  LASKLHGEYHGRVKLCLTYDEPLSHLIYAGADFILVPSMFEPCGLTQLTAMRYGSIPIVRKTGGLYDTVFDVDDDKDRAREQGLEPNGFSFEGADSNGVD
  YALDRAITTWYDARDWFHSLCKRVMEQDWTWNRPALDYMELYH
Full Sequence
Protein Sequence     Length: 1217     Download
MEMAHSPLCS RSRPVLVVRP ATAATGFAQP IIRCRRFTRT RLLRCLVASA DYSKRNPRRA    60
STPKPKGAAS RTYAPRPTVE SSMKKIGQSG TDEGDLGTSN GKLSSEATEQ TSNVEESSEV    120
DFSGNVSSSV FLEGMDDAFE AETEEEVEQN QSPELSSESM DDDAIDRKLD EYRGKISALI    180
SSKPEPTSVS STHVQDRSIV GFHEQEKSVV SFHEQDRSIV SVPEQSQPSS GVSGQNPTEE    240
KTIISGQDVT EEAPEEITGK SIEREPLSRE TEKVLFADDD PRIIKDEQYE PDIAPVQDDV    300
DPQVLRRRLE ELAEKNYLAG NKCFVFPEVV QADSVIDLYL NHSMSALASE PDILIKGAFN    360
GWRWKKFTQK MHKSELTGDW WCCKLHIPKQ AYRLDFVFFN GDTIYENNNH NDFVLQIESE    420
INEHSFEDFL VEEKQRELER LAAEEAERKR QAEEERRKEE ERAAMEADRA QAKAEVEMNK    480
NKLQNLLNSA SRYADNLWYI EPHTYKAGDR VKLFYNRSSR PLMHNTEIWM HGGYNNWSDG    540
LSIAEKLIKS YEKDGDWWYA DVTLPEGALV LDWVFADGPP GNARNYDNNG RQDFHAVVPN    600
NISEDLFWVE EEHMIFKRLQ KERKEREDAD RRKSEITAKM KAEMKEKTMR DFLLSQKHIV    660
YTEPLEVRAG TTVDVLYNPS NTVLNGKPEV WFRCSFNRWT HPSGPLPPQK MVNAENGSHL    720
RATVRVPLDA YMMDFVFSES EEGGIYDNRN GMDYHSPVTD SVAKEPPMHI VHIAVEMAPI    780
AKVGGLGDVV TSLSRAVQDL GHNVEVILPK YDCLNLSNVK DLHYRQSFTW GNTEIKVWFG    840
KVEDVPVYFL EPQNGMFWVG CVYGRNDESR FGFFCHSALE FLRQNGSSPD IIHCHDWSSA    900
PVAWLFKEQY AQNGLSNGRV VFTIHNLEFG AHHIGKAMAR CDKATTVSYT YSREVSGHGA    960
IAPHFSKFHG IRNGIDPDIW DPYSDNFIPV HYTSENVVEG KSAAKKALQQ RLGLQQTDTP    1020
VVGIISRLTV QKGIHLIKHA IYRTLERNGQ VVLLGSAPDH RIQGDFTNLA SKLHGEYHGR    1080
VKLCLTYDEP LSHLIYAGAD FILVPSMFEP CGLTQLTAMR YGSIPIVRKT GGLYDTVFDV    1140
DDDKDRAREQ GLEPNGFSFE GADSNGVDYA LDRAITTWYD ARDWFHSLCK RVMEQDWTWN    1200
RPALDYMELY HSARKN*                                                   1260
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02316PLN023169.0e-2460170124+
TIGR02095glgA9.0e-1477681213490+
PRK00654glgA2.0e-1567681216487+
cd03791GT1_Glycogen_synthase_DULL1_like2.0e-1677691212493+
PLN02316PLN02316022412151003+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0009058biosynthetic process
GO:0009536plastid
GO:0009987cellular process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACY56214.101121611216soluble starch synthase III-1 [Oryza sativa Japonica Group]
GenBankACY56216.101121611216soluble starch synthase III-1 [Oryza sativa Japonica Group]
GenBankACY56219.101121611216soluble starch synthase III-1 [Oryza sativa Indica Group]
EMBLCAE03511.203121611214OSJNBa0053K19.19 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001053933.101121611216Os04g0624600 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d1j_A076812111474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB3guh_A076812111474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4u_A076812111474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4t_A076812111474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2qzs_A076812111474A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisGLYCOGENSYN-RXNEC-2.4.1.21starch synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79475856565212150
HO77800369730610010
HO7947581094996050.13
HO7780031113033980.5
HO794758903143982.9
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.1.247.331Aquca_005_00047.1.247.331
Aquca_005_00047.1.247.331Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.2.581.669
Aquca_005_00047.2.581.669Aquca_005_00047.2.581.669Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673
Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509
Arabidopsis lyrata312200.125.208312200.125.208312200.125.208312200.474.562312200.474.562
312200.474.562312200.300.401312200.300.401312200.300.401
Arabidopsis thalianaAT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.1.154.237AT1G11720.1.154.237
AT1G11720.1.154.237AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.1.329.423
AT1G11720.1.329.423AT1G11720.1.329.423AT1G11720.2.548.636AT1G11720.2.548.636AT1G11720.2.548.636
AT1G11720.1.496.584AT1G11720.1.496.584AT1G11720.1.496.584
Brachypodium distachyonBradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi3g15027.1.835.918Bradi3g15027.1.835.918
Bradi3g15027.1.835.918Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.739.827
Bradi5g22310.1.739.827Bradi5g22310.1.739.827
Brassica rapaBra016818.430.514Bra016818.430.514Bra016818.430.514Bra019836.120.208Bra016818.605.694
Bra016818.605.694Bra016818.605.694Bra016818.767.855Bra016818.767.855Bra016818.767.855
Carica papayaevm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.486.575
evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735
Capsella rubellaCarubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.381.474Carubv10011175m.381.474
Carubv10011175m.381.474Carubv10011175m.547.635Carubv10011175m.547.635Carubv10011175m.547.635
Chlamydomonas reinhardtiiCre06.g282000.t2.1.660.749Cre06.g282000.t2.1.660.749Cre06.g282000.t1.3.696.785Cre06.g282000.t1.3.696.785Cre06.g282000.t2.1.308.399
Cre06.g282000.t2.1.308.399Cre06.g282000.t1.3.344.435Cre06.g282000.t1.3.344.435
Citrus clementinaCiclev10014319m.155.243Ciclev10014319m.155.243
Citrus sinensisorange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.452.540orange1.1g046057m.452.540
orange1.1g046057m.452.540orange1.1g046057m.612.700orange1.1g046057m.612.700orange1.1g046057m.612.700
Cucumis sativusCucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.1.269.352Cucsa.085800.1.269.352
Cucsa.085800.1.269.352Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.1.443.534
Cucsa.085800.1.443.534Cucsa.085800.1.443.534Cucsa.085800.2.607.694Cucsa.085800.2.607.694Cucsa.085800.2.607.694
Cucsa.085800.1.607.694Cucsa.085800.1.607.694Cucsa.085800.1.607.694
Eucalyptus grandisEucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.3.304.386Eucgr.D01324.3.304.386
Eucgr.D01324.3.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.1.309.391
Eucgr.D01324.1.309.391Eucgr.D01324.1.309.391Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567
Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.2.478.567Eucgr.D01324.2.478.567
Eucgr.D01324.2.478.567Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.4.639.727
Eucgr.D01324.4.639.727Eucgr.D01324.4.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727
Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.1.644.732Eucgr.D01324.1.644.732
Eucgr.D01324.1.644.732
Fragaria vescamrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.384.473
mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633
Glycine maxGlyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma15g11500.1.282.365Glyma15g11500.1.282.365
Glyma15g11500.1.282.365Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma15g11500.1.459.546
Glyma15g11500.1.459.546Glyma15g11500.1.459.546Glyma13g27480.1.442.529Glyma13g27480.1.442.529Glyma13g27480.1.442.529
Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma15g11500.1.618.706Glyma15g11500.1.618.706
Glyma15g11500.1.618.706Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma13g27480.1.601.689
Glyma13g27480.1.601.689Glyma13g27480.1.601.689
Gossypium raimondiiGorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.5.192.274Gorai.011G013800.5.192.274
Gorai.011G013800.5.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.3.192.274
Gorai.011G013800.3.192.274Gorai.011G013800.3.192.274Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352
Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.009G178700.6.279.362Gorai.009G178700.6.279.362
Gorai.009G178700.6.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.4.157.240
Gorai.009G178700.4.157.240Gorai.009G178700.4.157.240Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362
Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.1.279.362Gorai.009G178700.1.279.362
Gorai.009G178700.1.279.362Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.5.366.455
Gorai.011G013800.5.366.455Gorai.011G013800.5.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455
Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.2.444.533Gorai.011G013800.2.444.533
Gorai.011G013800.2.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.009G178700.6.454.543
Gorai.009G178700.6.454.543Gorai.009G178700.6.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543
Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.3.454.543Gorai.009G178700.3.454.543
Gorai.009G178700.3.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.1.454.543
Gorai.009G178700.1.454.543Gorai.009G178700.1.454.543Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703
Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.4.493.581Gorai.009G178700.4.493.581
Gorai.009G178700.4.493.581Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.2.615.703
Gorai.009G178700.2.615.703Gorai.009G178700.2.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703
Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.5.528.615Gorai.011G013800.5.528.615
Gorai.011G013800.5.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.3.528.615
Gorai.011G013800.3.528.615Gorai.011G013800.3.528.615Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693
Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693
Linum usitatissimumLus10020044.225.308Lus10020044.225.308Lus10020044.225.308Lus10006780.228.311Lus10006780.228.311
Lus10006780.228.311Lus10006780.565.653Lus10006780.565.653Lus10006780.565.653Lus10020044.562.650
Lus10020044.562.650Lus10020044.562.650Lus10006780.404.493Lus10006780.404.493Lus10006780.404.493
Lus10020044.401.490Lus10020044.401.490Lus10020044.401.490
Malus domesticaMDP0000191201.257.340MDP0000191201.257.340MDP0000191201.257.340MDP0000151462.257.340MDP0000151462.257.340
MDP0000151462.257.340MDP0000252413.204.287MDP0000252413.204.287MDP0000191201.433.521MDP0000191201.433.521
MDP0000191201.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000585054.156.244
MDP0000585054.156.244MDP0000252413.380.468MDP0000252413.380.468MDP0000191201.594.681MDP0000191201.594.681
MDP0000191201.594.681MDP0000151462.594.681MDP0000151462.594.681MDP0000151462.594.681
Manihot esculentacassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_001042m.91.174cassava4.1_001042m.91.174
cassava4.1_001042m.91.174cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_001042m.261.348
cassava4.1_001042m.261.348cassava4.1_001042m.261.348cassava4.1_001042m.421.508cassava4.1_001042m.421.508cassava4.1_001042m.421.508
cassava4.1_000528m.601.688cassava4.1_000528m.601.688cassava4.1_000528m.601.688
Mimulus guttatusmgv1a000364m.363.446mgv1a000364m.363.446mgv1a000364m.670.758mgv1a000364m.670.758
Oryza sativaLOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.1.906.989LOC_Os08g09230.1.906.989
LOC_Os08g09230.1.906.989LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.508.598
LOC_Os04g53310.1.508.598LOC_Os04g53310.1.508.598LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758
Panicum virgatumPavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00009477m.238.321Pavirv00009477m.238.321
Pavirv00009477m.238.321Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00009007m.640.723
Pavirv00009007m.640.723Pavirv00009007m.640.723Pavirv00069992m.620.703Pavirv00069992m.620.703Pavirv00069992m.620.703
Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.487.575Pavirv00054440m.487.575
Pavirv00054440m.487.575Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00009477m.412.502
Pavirv00009477m.412.502Pavirv00009477m.412.502Pavirv00009477m.574.662Pavirv00009477m.574.662Pavirv00009477m.574.662
Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.824.912Pavirv00019877m.824.912
Pavirv00019877m.824.912Pavirv00009007m.815.902Pavirv00009007m.815.902Pavirv00009007m.815.902
Phaseolus vulgarisPhvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.003G078800.1.198.283Phvul.003G078800.1.198.283
Phvul.003G078800.1.198.283Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.003G078800.1.377.463
Phvul.003G078800.1.377.463Phvul.003G078800.1.377.463Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705
Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624
Picea abiesMA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.377.467MA_10437241g0010.377.467
MA_10437241g0010.377.467MA_10437241g0010.540.629MA_10437241g0010.540.629MA_10437241g0010.540.629
Populus trichocarpaPotri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.1.281.364Potri.004G014100.1.281.364
Potri.004G014100.1.281.364Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.1.456.545
Potri.004G014100.1.456.545Potri.004G014100.1.456.545Potri.004G014100.2.498.586Potri.004G014100.2.498.586Potri.004G014100.2.498.586
Potri.004G014100.1.617.705Potri.004G014100.1.617.705Potri.004G014100.1.617.705
Prunus persicappa001074m.35.118ppa001074m.35.118ppa001074m.35.118ppa001074m.211.299ppa001074m.211.299
ppa001074m.211.299ppa001074m.372.460ppa001074m.372.460ppa001074m.372.460
Ricinus communis29842.m003588.184.26729842.m003588.184.26729842.m003588.184.26729842.m003588.389.47729842.m003588.389.477
29842.m003588.389.47729842.m003588.550.63729842.m003588.550.63729842.m003588.550.637
Setaria italicaSi013121m.535.618Si013121m.535.618Si013121m.535.618Si009214m.272.354Si009214m.272.354
Si009214m.272.354Si015393m.625.708Si015393m.625.708Si015393m.625.708Si009214m.445.535
Si009214m.445.535Si009214m.445.535Si009214m.607.695Si009214m.607.695Si009214m.607.695
Si013121m.706.793Si013121m.706.793Si013121m.706.793Si013121m.868.956Si013121m.868.956
Si013121m.868.956Si015393m.801.887Si015393m.801.887Si015393m.801.887
Selaginella moellendorffii154776.15.97154776.15.97154776.15.97154776.189.279154776.189.279
154776.189.279154776.351.441154776.351.441154776.351.441
Sorghum bicolorSb06g029050.1.309.392Sb06g029050.1.309.392Sb06g029050.1.309.392Sb07g005400.1.782.865Sb07g005400.1.782.865
Sb07g005400.1.782.865Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.645.733
Sb06g029050.1.645.733Sb06g029050.1.645.733
Thellungiella halophilaThhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006631m.209.292Thhalv10006631m.209.292
Thhalv10006631m.209.292Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006631m.384.477
Thhalv10006631m.384.477Thhalv10006631m.384.477Thhalv10006781m.549.638Thhalv10006781m.549.638Thhalv10006781m.549.638
Thhalv10006631m.549.638Thhalv10006631m.549.638Thhalv10006631m.549.638
Vitis viniferaGSVIVT01012723001.340.428GSVIVT01012723001.340.428GSVIVT01012723001.500.588GSVIVT01012723001.500.588
Volvox carteriVocar20002632m.688.777Vocar20002632m.688.777Vocar20002632m.313.404Vocar20002632m.313.404
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)