y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os05g15510.2
FamilyGH5
Protein PropertiesLength: 526 Molecular Weight: 57788.1 Isoelectric Point: 6.3234
ChromosomeChromosome/Scaffold: 5 Start: 8769532 End: 8774386
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52345101.19993e-41
  PILRNHWSTYIVEDDFKFISASGLTAVRIPVGWWIASDPNPPAPYVGGSLQTLDNAFKWAEKYKLGVIIDLHAAPGSQNPWEHSSSRDGTQEWGTSDANI
  AETVQVIDFLASRYAKSPSLLAVELMNEPFAPRATLESLMKYYHDGYNAVRKYSSTAYVIMSNRLGPHDPTEFLQFANGFPRAVIDVHYYTVFNDLFNNL
  TVQQNIDFIKSNFSSELKNVTTQNGPLTFVGEWVAEWRVPNATKEEYQRYAKVQMDVYGQATFGWSYWTLKNVNNHW
Full Sequence
Protein Sequence     Length: 526     Download
MMSSRLLKRA CLLLLVSSWL CSLSDAKRKT PPSPPPPPSS FGLPVRAVCL GGWLVTEGWI    60
LPSLFDAIPN KDLLDGAQLQ LKAVAAGAYL TAADQGGAAA VVANRTQAAP SASETFKLWR    120
INETTFNFRA SSGRFVGAGS DGGAAVVAVA AAPGPSETFQ VVRDDGDKSR VRIRAPNGHF    180
LQIALGSNSV TADYYGESTS WGDDDPSVFV VTKVLELQGE YQICNGYGTA KATPILRNHW    240
STYIVEDDFK FISASGLTAV RIPVGWWIAS DPNPPAPYVG GSLQTLDNAF KWAEKYKLGV    300
IIDLHAAPGS QNPWEHSSSR DGTQEWGTSD ANIAETVQVI DFLASRYAKS PSLLAVELMN    360
EPFAPRATLE SLMKYYHDGY NAVRKYSSTA YVIMSNRLGP HDPTEFLQFA NGFPRAVIDV    420
HYYTVFNDLF NNLTVQQNID FIKSNFSSEL KNVTTQNGPL TFVGEWVAEW RVPNATKEEY    480
QRYAKVQMDV YGQATFGWSY WTLKNVNNHW NLEWMINNGY ISLKT*                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00150Cellulase6.0e-17224505289+
COG2730BglC2.0e-27211520358+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005488binding
GO:0005623cell
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY97220.1015251518hypothetical protein OsI_19139 [Oryza sativa Indica Group]
GenBankEEE62967.1015251546hypothetical protein OsJ_17774 [Oryza sativa Japonica Group]
RefSeqNP_001055011.1015251525Os05g0244500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150774.10752411538cellulase containing protein [Zea mays]
RefSeqXP_002440848.101752420538hypothetical protein SORBIDRAFT_09g008170 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A3e-3422051945376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB3n9k_A4e-3422051950381A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB2pc8_A4e-3422051951382A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ7787112872245090
FF3576472841704530
CJ7223622861684530
EG3886702821724530
DC8989053701545230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)