y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os05g17604.1
FamilyCBM57
Protein PropertiesLength: 1018 Molecular Weight: 112175 Isoelectric Point: 6.5164
ChromosomeChromosome/Scaffold: 5 Start: 10112499 End: 10126194
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM574295896.1e-28
  FAVDCGSNASIRGSDDTIYEADPTNLGAATYYVTGQTRWGVSSVGNAIDAKNIIYSSQPFQNVVDSELFETARMSSSSLRYYGLGLENGNYTVLLQFAEL
  AFPDSQTWLSLGRRVFDIYIQGALKQKDFDIRKTAGGKSFTVVNRSFMVTVSKNFLEIHLF
Full Sequence
Protein Sequence     Length: 1018     Download
MRSCSIRGVI RHHLAWLVLI LCSWRVAAAQ DQQAPKTDPV EAAALNTILG RWGKKASPEW    60
NISGELCSGF AADKTDWDNY RDINPFIKCD CTFNNNTLCH ITRLRVTYLD VVGQIPAELQ    120
NLTHLVDLNL FRNYLTGPIP SFIGKFTSMQ YLSLSFNPLS GLLPKELGNL TNLLSLGISS    180
DNFTGSLPEE LGNLTKLQQL YFDSSGFSGP FPSSFSKLQN LKFLSASDNV FKGKIPAYLG    240
TMTNLEDIAF HGNSFEGPVP ESLSNLTKLT RLWIGDIING VSPLAFISNM ASLSTLILRN    300
CKISSDLGAV EFSMFKQLKL LDLSFNNITG EVPQSILNLG NLNSLFLGNN SLTGKLPDGI    360
SSSLKVIDFS YNQLTGSIPS WARQNNLQLN LVANNFLLDT TSESTLPWGI NCLQQDTPCF    420
RGSPEYYSFA VDCGSNASIR GSDDTIYEAD PTNLGAATYY VTGQTRWGVS SVGNAIDAKN    480
IIYSSQPFQN VVDSELFETA RMSSSSLRYY GLGLENGNYT VLLQFAELAF PDSQTWLSLG    540
RRVFDIYIQG ALKQKDFDIR KTAGGKSFTV VNRSFMVTVS KNFLEIHLFW AGKGTVDIPT    600
KDNYYGPMIS ALSVTPNFTP TVRNGIPKRK SKAGAISGIL IGAIVLVLAA LFGVFTLVKK    660
RRALAQQKEE LYNLVGRPDV FSYAELKLAT DNFSSQNILG EGGFGPVYKG KLPDERVIAV    720
KQLSQSSHQG TSQFVTEVAT ISAVQHRNLV ILHGCCIDSK TPLLVYEYLE NGSLDRAIFG    780
DSNLNLDWVM RFEIILGIAR GLTYLHEESS VRIVHRDIKA SNVLLDTNLI PKISDFGLAK    840
LYDENQTHVS TRIAGTLGYL APEYAMRGHL SEKADIFAFG VVMLETVAGR PNTDNSLEES    900
KICLLEWAWG LYEMDQALGI VDPSLKEFDK DEAFRVIYVA LVCTQGSPHQ RPPMSKVVTM    960
LTGDVDVAKV VTKPSYITEW QLRGGGYSSN TTSSYAWSSN PELSRQKEIT EVSLQVR*      1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00192PTKc1.0e-43697885202+
smart00221STYKc1.0e-43698885195+
smart00219TyrKc1.0e-44698885195+
cd00180PKc5.0e-45699885191+
pfam11721Malectin5.0e-52427612187+
Gene Ontology
GO TermDescription
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0005886plasma membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE63030.10.000298260649810hypothetical protein OsJ_17838 [Oryza sativa Japonica Group]
GenBankEEE63030.10.00000000411326095241hypothetical protein OsJ_17838 [Oryza sativa Japonica Group]
GenBankEEE63030.1011771251576hypothetical protein OsJ_17838 [Oryza sativa Japonica Group]
GenBankEEE63030.1012310176021448hypothetical protein OsJ_17838 [Oryza sativa Japonica Group]
RefSeqNP_001052392.104499030972Os04g0291900 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ulz_A06659646309A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds
PDB3uim_A06659646309A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation
PDB3tl8_H066596414317B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_G066596414317B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_D066596414317B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Transmembrane Domains
StartEnd
636658
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6729283055948980
CB6608492906058940
CB67292726812680
CB6303842846158980
CB672927101981980.000000006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00368.2Aquca_030_00368.1
Arabidopsis lyrata883240.424.594883240.424.594892639892640892638
Arabidopsis thalianaAT1G56130.1AT1G56140.1AT1G56120.1AT1G56145.2AT1G56145.1
Brachypodium distachyonBradi5g21870.2Bradi5g21857.1Bradi3g17756.2Bradi3g17756.1Bradi1g48230.1
Brassica rapaBra003333Bra007909Bra007908Bra030813Bra030815
Bra033670Bra035966Bra033958Bra007907Bra016226
Carica papayaevm.model.supercontig_2207.1evm.model.supercontig_748.4
Capsella rubellaCarubv10008172mCarubv10012587mCarubv10010895mCarubv10008256mCarubv10008071m.409.563
Carubv10008071m.409.563Carubv10008183m
Citrus clementinaCiclev10007054mCiclev10007687mCiclev10007686mCiclev10018029mCiclev10018038m
Ciclev10014641mCiclev10014117m
Citrus sinensisorange1.1g001658morange1.1g008072morange1.1g006515morange1.1g006206morange1.1g004413m
orange1.1g002562morange1.1g002581morange1.1g038019m
Cucumis sativusCucsa.239700.2Cucsa.239700.1
Eucalyptus grandisEucgr.F04434.2Eucgr.F04434.1Eucgr.F04306.1Eucgr.F04441.1Eucgr.F02391.1
Eucgr.F04436.1Eucgr.C02767.1Eucgr.L01594.1Eucgr.F04301.1Eucgr.L01787.1
Eucgr.B01468.1Eucgr.F04437.1
Fragaria vescamrna11624.1-v1.0-hybridmrna16334.1-v1.0-hybridmrna30033.1-v1.0-hybridmrna28048.1-v1.0-hybrid
Glycine maxGlyma09g15200.3Glyma09g15200.2Glyma09g15200.1Glyma08g25590.2Glyma08g25600.2
Glyma08g25600.1
Gossypium raimondiiGorai.002G105800.1Gorai.001G034000.1Gorai.011G052100.1Gorai.N011200.1Gorai.011G052400.2
Gorai.011G052400.1Gorai.001G131900.1Gorai.006G091400.1Gorai.011G052300.5Gorai.011G052300.4
Gorai.011G052300.3Gorai.011G052300.2Gorai.011G052300.1Gorai.011G052000.1Gorai.011G052600.8
Gorai.011G052600.7Gorai.011G052600.6Gorai.011G052600.5Gorai.011G052600.4Gorai.011G052600.3
Gorai.011G052600.2Gorai.011G052600.1
Linum usitatissimumLus10031199
Malus domesticaMDP0000210289MDP0000183693.203.372MDP0000183693.203.372MDP0000213902MDP0000251746
MDP0000269684MDP0000267728MDP0000281046MDP0000207688MDP0000183693.772.939
MDP0000183693.772.939MDP0000389758MDP0000278907MDP0000306337MDP0000384033
MDP0000171164MDP0000307776MDP0000212717MDP0000311945MDP0000308237
MDP0000283397MDP0000122720
Manihot esculentacassava4.1_001509mcassava4.1_001407mcassava4.1_025733mcassava4.1_030674m
Mimulus guttatusmgv1a002601mmgv1a018669mmgv1a000612m
Oryza sativaLOC_Os04g22470.1LOC_Os08g10300.1LOC_Os08g10290.1LOC_Os04g52640.3LOC_Os04g52640.2
LOC_Os04g52640.1LOC_Os04g52600.1LOC_Os04g52630.1LOC_Os05g17810.1LOC_Os04g52614.1
LOC_Os08g10330.1LOC_Os05g17604.6LOC_Os05g17604.5LOC_Os05g17604.4LOC_Os05g17604.3
LOC_Os05g17604.2LOC_Os05g16430.1LOC_Os08g10320.3LOC_Os08g10320.2LOC_Os08g10320.1
LOC_Os08g10310.3LOC_Os08g10310.2LOC_Os08g10310.1LOC_Os04g52606.1LOC_Os05g16930.1
LOC_Os06g07130.1LOC_Os04g52590.1LOC_Os08g10250.1LOC_Os05g16824.4LOC_Os05g16824.3
LOC_Os05g16824.2LOC_Os05g16824.1LOC_Os05g16740.1
Panicum virgatumPavirv00010367mPavirv00021132mPavirv00063388mPavirv00039446mPavirv00006527m
Pavirv00041471mPavirv00039639mPavirv00031150mPavirv00014784mPavirv00036213m
Pavirv00070332mPavirv00032467mPavirv00022623mPavirv00048042m
Physcomitrella patensPp1s244_27V6.2
Phaseolus vulgarisPhvul.011G169300.1
Picea abiesMA_170647g0010MA_162469g0010MA_73800g0010MA_8849269g0010MA_18275g0010
MA_17053g0010MA_954053g0010MA_54077g0010MA_10436782g0010MA_404302g0010
MA_461914g0010
Populus trichocarpaPotri.006G255100.2Potri.018G026800.2Potri.018G026800.1Potri.006G255100.1Potri.001G082900.5
Potri.001G082900.4Potri.001G082900.3Potri.001G082900.2Potri.001G082900.1Potri.003G148000.3
Potri.003G148000.2Potri.003G148000.1Potri.007G067900.3Potri.007G067900.2Potri.007G067900.1
Prunus persicappa017326mppa017049mppa001211mppa001152mppa000802m
ppa015982mppa026535m
Ricinus communis29848.m00461730169.m00632829497.m00008929624.m000325
Setaria italicaSi013203mSi013191mSi013178mSi009240mSi012655m
Si009468mSi009463mSi009322mSi028769mSi028790m
Si009325mSi009466mSi009259mSi006097m
Selaginella moellendorffii438852
Sorghum bicolorSb07g005820.1Sb06g028570.1Sb06g028560.1Sb10g004730.1
Thellungiella halophilaThhalv10012006mThhalv10018064mThhalv10011215mThhalv10016280mThhalv10016175m
Thhalv10019658mThhalv10012222m
Vitis viniferaGSVIVT01037993001.434.602GSVIVT01037993001.434.602GSVIVT01035865001GSVIVT01013621001GSVIVT01029720001.503.674
GSVIVT01029720001.503.674GSVIVT01037982001GSVIVT01038011001GSVIVT01013608001GSVIVT01013612001
GSVIVT01029718001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)