y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os05g23350.1
FamilyGH10
Protein PropertiesLength: 572 Molecular Weight: 62807.7 Isoelectric Point: 6.2934
ChromosomeChromosome/Scaffold: 5 Start: 13327998 End: 13330268
Descriptionglycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH102255100
  ENRFPFGSCINKTAIRNPKFVDFFCENFDWAVFENELKWYSTEPQRGQINYRDADELLDFCHRYGKSARGHCIFWAVDGDVQQWVKDLGRDDLAAAVQGR
  LHGLLSRYAGRFRHYDVNNEMLHGRFYRDRLGDGVAPLMFREAARLDPAARLFVNDYNVLRGNDPNATPEKYVELVDALRRGGAAVGGIGVQGHMDSPVA
  GQVIRAALDKLAAAGGAPIWITELDVSEPDVGLRADDLEVVLREAYAHPAVEGVVLWGFMEGQMWRRDAYLVDADGTVNEAGQRFL
Full Sequence
Protein Sequence     Length: 572     Download
MALAHEVAFE VNLIEDDGGL AGWAPVGTRT ALSSHAERDT AMLISGAVSA AEPNERIRRS    60
SGRYIVASRR ADEEDGLRRA VPAGALVPRV TYRVVGWVSV QGQGDGRHHA VRVGLRVDGD    120
GGDDERGSWL DCGAARVEVG GGWAEINGAF RLRASPRVAA VHVHGAPAGV DVKVMDLQVY    180
ATDRKARLTQ LKEQTDKVRK RDVILNLGGG ATMAGASIRV AQLLENRFPF GSCINKTAIR    240
NPKFVDFFCE NFDWAVFENE LKWYSTEPQR GQINYRDADE LLDFCHRYGK SARGHCIFWA    300
VDGDVQQWVK DLGRDDLAAA VQGRLHGLLS RYAGRFRHYD VNNEMLHGRF YRDRLGDGVA    360
PLMFREAARL DPAARLFVND YNVLRGNDPN ATPEKYVELV DALRRGGAAV GGIGVQGHMD    420
SPVAGQVIRA ALDKLAAAGG APIWITELDV SEPDVGLRAD DLEVVLREAY AHPAVEGVVL    480
WGFMEGQMWR RDAYLVDADG TVNEAGQRFL QLQREWRSDA RGIVDGDGRF KFRGFHGTYV    540
AQVTTATGKM LKTFTVEKGD NSLELDLDIE I*                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3693XynA4.0e-25204494316+
pfam00331Glyco_hydro_102.0e-57220510311+
smart00633Glyco_108.0e-60261509270+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005575cellular_component
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY97420.1015711571hypothetical protein OsI_19350 [Oryza sativa Indica Group]
GenBankEAY97421.102135711359hypothetical protein OsI_19351 [Oryza sativa Indica Group]
GenBankEAY97529.1015691581hypothetical protein OsI_19457 [Oryza sativa Indica Group]
GenBankEEE63139.1015711571hypothetical protein OsJ_17947 [Oryza sativa Japonica Group]
RefSeqNP_001055187.1015691581Os05g0319900 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1tux_A1e-332155031289A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1i1x_A2e-332165032289A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1i1w_A2e-332165032289A Chain A, 0.89a Ultra High Resolution Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB2bnj_A7e-332165032289A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1gor_A6e-322165032289A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6475972501333820
FL8605972422815200
GO8509733311504780
HO1599882142164280
DR1104362792265040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.4.344.628Aquca_017_00095.3.344.628Aquca_017_00095.2.564.848Aquca_017_00095.1.577.861Aquca_006_00211.1
Aquca_003_00413.1Aquca_011_00218.1.200.461Aquca_011_00219.1.223.486Aquca_006_00211.2
Arabidopsis lyrata475392.571.844489729.403.684490628913024.223.481491296
491295.221.480353449353450480358
Arabidopsis thalianaAT1G58370.1.570.844AT4G08160.1.404.685AT4G08160.2.404.657AT4G38650.1AT4G38300.1
AT4G33830.1.222.485AT4G33840.1.222.480AT4G33860.1.222.480AT4G33820.1AT4G33810.1
AT2G14690.1
Brachypodium distachyonBradi1g12710.1.410.670Bradi2g02320.1.243.531Bradi2g02330.1Bradi1g27257.1.195.481Bradi5g04640.1
Bradi1g68310.1Bradi3g24410.1Bradi1g71040.1.232.494Bradi1g71076.1Bradi1g71050.1
Brassica rapaBra031698.712.996Bra027867.572.849Bra039768.635.918Bra010733Bra017609.315.575
Bra034585.221.481Bra034584.220.481Bra034586Bra036392Bra017610
Carica papayaevm.model.supercontig_160.18.423.706evm.model.supercontig_160.19.570.841evm.model.supercontig_37.165evm.model.supercontig_106.45.230.491evm.model.supercontig_169.45
evm.model.supercontig_106.44
Capsella rubellaCarubv10008217m.613.898Carubv10019737m.593.868Carubv10000293m.404.688Carubv10004489mCarubv10004963m
Carubv10006586m.221.480Carubv10006745mCarubv10004408mCarubv10015996m
Citrus clementinaCiclev10000171m.611.880Ciclev10030219mCiclev10028121mCiclev10030382m.227.489Ciclev10028089m
Citrus sinensisorange1.1g002447m.574.843orange1.1g036715morange1.1g035723morange1.1g042396morange1.1g008838m
Cucumis sativusCucsa.353160.7.566.835Cucsa.353160.4.599.868Cucsa.353160.1.599.868Cucsa.353160.8.341.611Cucsa.143690.1.601.869
Cucsa.169000.1Cucsa.219120.1Cucsa.298380.1
Eucalyptus grandisEucgr.F00109.1.537.816Eucgr.F00108.3.544.819Eucgr.F00108.2.583.858Eucgr.F00108.1.587.862Eucgr.F02205.1.452.713
Eucgr.I01059.1Eucgr.G01773.1Eucgr.I01060.1Eucgr.I01061.1Eucgr.G01210.1
Eucgr.G01205.1Eucgr.G01215.1Eucgr.G01214.1Eucgr.G01217.1Eucgr.G01206.1
Eucgr.G01213.1Eucgr.G01209.1
Fragaria vescamrna02649.1-v1.0-hybrid.593.860mrna07626.1-v1.0-hybridmrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976
mrna28152.1-v1.0-hybrid.228.491mrna25508.1-v1.0-hybrid.175.436mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484
Glycine maxGlyma14g10456.2.555.825Glyma14g10456.1.584.854Glyma06g05290.1.396.666Glyma04g05220.3.395.665Glyma04g05220.2.395.665
Glyma17g35060.2.585.853Glyma17g35060.1.556.824Glyma06g00680.1Glyma04g00610.2Glyma04g00610.1
Glyma11g11220.1.211.472Glyma11g11200.1.222.493Glyma20g27040.1Glyma10g40300.2Glyma10g40300.1
Glyma10g40293.1
Gossypium raimondiiGorai.009G223500.6.425.707Gorai.009G223500.5.565.847Gorai.009G223500.4.564.846Gorai.009G223500.3.565.847Gorai.009G223500.2.564.846
Gorai.009G223500.1.565.847Gorai.009G223600.1.421.696Gorai.010G029100.1.585.855Gorai.005G231200.1Gorai.008G020100.2
Gorai.008G020100.1Gorai.005G231100.2Gorai.005G231100.1Gorai.002G195600.1.359.528Gorai.002G195600.1.359.528
Gorai.002G195600.1.359.528Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.280.355
Gorai.002G195600.1.280.355Gorai.002G195600.1.280.355
Linum usitatissimumLus10007242.429.712Lus10028242.428.711Lus10025054Lus10033786.213.477Lus10014642.218.482
Lus10020985.202.471Lus10033784Lus10034490Lus10014646
Malus domesticaMDP0000225641.598.870MDP0000246856MDP0000249571MDP0000245498.229.493MDP0000144523
MDP0000779011MDP0000146624.768.905MDP0000146624.768.905MDP0000132261MDP0000146624.669.763
MDP0000146624.669.763
Manihot esculentacassava4.1_002200m.411.692cassava4.1_001250m.571.847cassava4.1_001252m.573.850cassava4.1_001320m.557.841cassava4.1_033386m
cassava4.1_029937mcassava4.1_021918m.217.482cassava4.1_021990mcassava4.1_028847mcassava4.1_026436m
Medicago truncatulaMedtr3g117800.1Medtr7g024420.1Medtr1g106800.1Medtr1g106790.1Medtr1g106910.1
Medtr1g106770.1
Mimulus guttatusmgv1a027071m.549.820mgv1a000981m.578.858mgv1a020606mmgv1a003597m.225.485mgv1a023132m
mgv1a024427mmgv1a003542mmgv1a019481mmgv1a025021mmgv1a022322m
mgv1a004157mmgv1a004760mmgv1a021702mmgv1a004887m
Oryza sativaLOC_Os03g47010.1.411.694LOC_Os01g04300.1.211.499LOC_Os01g04290.1LOC_Os05g25560.1LOC_Os03g14010.3
LOC_Os03g14010.2LOC_Os03g14010.1LOC_Os05g23924.2LOC_Os05g23924.1LOC_Os03g10469.2
LOC_Os03g10469.1LOC_Os10g21110.1LOC_Os03g10440.1.227.490LOC_Os03g10478.1.232.497LOC_Os10g21100.1
Panicum virgatumPavirv00018091m.408.690Pavirv00043679m.401.686Pavirv00043214mPavirv00009472m.233.513Pavirv00011920m
Pavirv00064836mPavirv00011543mPavirv00004670mPavirv00012621mPavirv00003316m
Pavirv00046655mPavirv00001379mPavirv00041480mPavirv00066390mPavirv00041724m
Pavirv00066756mPavirv00064807mPavirv00011965mPavirv00070694m.721.846Pavirv00049463m
Pavirv00011967mPavirv00011966mPavirv00027101m.191.313Pavirv00026745m.214.317
Physcomitrella patensPp1s121_107V6.1.717.999
Phaseolus vulgarisPhvul.009G075400.1.397.677Phvul.001G032300.2.556.827Phvul.001G032300.1.583.854Phvul.009G120500.1Phvul.011G033100.1.217.499
Phvul.007G045400.1Phvul.007G045500.1Phvul.007G045900.1
Picea abiesMA_9039435g0010.206.470MA_350255g0010MA_604666g0010MA_10433351g0010MA_9354042g0010
MA_429144g0010.244.407MA_8357324g0010
Populus trichocarpaPotri.002G113100.2.412.693Potri.004G173300.4Potri.004G173300.3Potri.004G173300.2Potri.004G173300.1
Potri.009G087900.1.202.466Potri.009G087800.3Potri.009G087800.2Potri.009G087800.1Potri.009G087700.2
Potri.009G087700.1Potri.009G087600.1
Prunus persicappa001089m.567.845ppa004290mppa016947mppa021363m.219.483ppa023031m
ppa024827m
Ricinus communis30170.m013644.481.75830170.m01364629492.m00007029812.m00019629812.m000195.218.483
29812.m00019429812.m00019958888.m000026
Setaria italicaSi038956m.406.689Si000821mSi000630m.297.586Si025026mSi034995m.207.495
Si001255mSi034968mSi039948mSi034867m.230.491Si039549m
Si039641mSi034912m.223.486
Selaginella moellendorffii111304.535.794420481.257.518
Sorghum bicolorSb01g012210.1.405.688Sb03g006980.1.246.530Sb03g006950.1.218.506Sb04g020543.1Sb01g041310.1
Sb06g003350.1Sb01g043760.1Sb02g004490.1Sb01g043730.1Sb01g043720.1
Thellungiella halophilaThhalv10023244m.581.848Thhalv10028466m.388.667Thhalv10024805mThhalv10027468m.221.481Thhalv10024995m.219.458
Thhalv10023172m
Vitis viniferaGSVIVT01009272001.602.834GSVIVT01024049001GSVIVT01037833001.244.520GSVIVT01037833001.244.520GSVIVT01037832001
GSVIVT01037825001.197.461
Volvox carteriVocar20000377mVocar20006952m
Zea maysAC204711.3_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)