y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os06g09240.1
FamilyGT1
Protein PropertiesLength: 455 Molecular Weight: 47281.9 Isoelectric Point: 6.6459
ChromosomeChromosome/Scaffold: 6 Start: 4647954 End: 4649523
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1694302.9e-28
  APPPDAPPPRRMAVFMEAAEAGGVVEAGLEAARAAAGGVAVSCVVGDAFVWMAADAAAKVGARWVPVWTGASSALVAHLRTDALRDDVGDEAASRADELL
  TSHPGLESYRIRDLPDGVVSGDLNYVINLLLHRMAQRLPRAATAVALNTFPGLDPPTVTAALTAVLPTCLPLGPYHLLATAPANDDDPNGCLAWLDRHAP
  RTVAYVSFGTVASPRPDELRELAAGLEASGAPFLWSLREDSWPLLPPGFLERTKQHAAAGLVVPWAPQVGVLRHASVGAFVTHAGWASVMEGASSGVPMA
  CRPFFGDQRTNARSVSHVWGFGTAFDGAMTRGGVATAVASLVGGEDGRRMRARAQELQAKVA
Full Sequence
Protein Sequence     Length: 455     Download
MAHVAVVTFP FSSHAAVLLS FARALAAASP ASTFSFLSTA ASFAHLRKTA AAGDLLPGNM    60
RFVEVADGAP PPDAPPPRRM AVFMEAAEAG GVVEAGLEAA RAAAGGVAVS CVVGDAFVWM    120
AADAAAKVGA RWVPVWTGAS SALVAHLRTD ALRDDVGDEA ASRADELLTS HPGLESYRIR    180
DLPDGVVSGD LNYVINLLLH RMAQRLPRAA TAVALNTFPG LDPPTVTAAL TAVLPTCLPL    240
GPYHLLATAP ANDDDPNGCL AWLDRHAPRT VAYVSFGTVA SPRPDELREL AAGLEASGAP    300
FLWSLREDSW PLLPPGFLER TKQHAAAGLV VPWAPQVGVL RHASVGAFVT HAGWASVMEG    360
ASSGVPMACR PFFGDQRTNA RSVSHVWGFG TAFDGAMTRG GVATAVASLV GGEDGRRMRA    420
RAQELQAKVA SAFVEPDGSC RKNFAKFVEI ICAS*                               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025552.0e-37241449230+
PLN03007PLN030071.0e-39255449213+
PLN02448PLN024482.0e-41131452342+
PLN02410PLN024102.0e-44208451251+
pfam00201UDPGT4.0e-97132452389+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0009628response to abiotic stimulus
GO:0016740transferase activity
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY99982.19e-19160160hypothetical protein OsI_21986 [Oryza sativa Indica Group]
GenBankEAY99982.1013945438353hypothetical protein OsI_21986 [Oryza sativa Indica Group]
GenBankEEE65246.1014541407hypothetical protein OsJ_20419 [Oryza sativa Japonica Group]
RefSeqNP_001057034.1014541454Os06g0192100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002436626.10345211470hypothetical protein SORBIDRAFT_10g006140 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A034519450A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2c1z_A034519450A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2c1x_A034519450A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A0145313454A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A0145313454A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanin biosynthesis (delphinidin 3-O-glucoside)RXN-7815EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside)PELUDP-RXNEC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside)RXN1F-775EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN1F-775EC-2.4.1.115anthocyanidin 3-O-glucosyltransferase
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG3856682741323990
EG3965742901324100
EG3782692182414520
FL8037452192414520
EG3805302521333750
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)