| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os06g17110.1 |
| Family | GT1 |
| Protein Properties | Length: 135 Molecular Weight: 14147.2 Isoelectric Point: 4.697 |
| Chromosome | Chromosome/Scaffold: 6 Start: 9916482 End: 9916953 |
| Description | UDP-glucosyl transferase 89B1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 6 | 110 | 1.4e-21 |
| WAPQLAALRHRAVGWFVTHSGWISVVEAVAAGVAMLTWPMVADQFVNARLVVDELRAAVPVSWGGVAVPPSANEVARVLEATVLAADGGEVGARVEELAV EAAAA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 135 Download |
| MVIRGWAPQL AALRHRAVGW FVTHSGWISV VEAVAAGVAM LTWPMVADQF VNARLVVDEL 60 RAAVPVSWGG VAVPPSANEV ARVLEATVLA ADGGEVGARV EELAVEAAAA TREGGSSWVE 120 VDELVRELGG HMQR* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02207 | PLN02207 | 2.0e-17 | 2 | 64 | 63 | + UDP-glycosyltransferase | ||
| PLN03004 | PLN03004 | 4.0e-20 | 1 | 85 | 85 | + UDP-glycosyltransferase | ||
| PLN02534 | PLN02534 | 2.0e-22 | 1 | 69 | 75 | + UDP-glycosyltransferase | ||
| PLN03007 | PLN03007 | 3.0e-23 | 1 | 66 | 66 | + UDP-glucosyltransferase family protein | ||
| PLN02863 | PLN02863 | 1.0e-31 | 1 | 88 | 88 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005575 | cellular_component |
| GO:0008152 | metabolic process |
| GO:0016740 | transferase activity |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAD69134.1 | 0 | 2 | 130 | 345 | 482 | putative UDP-glycosyltransferase [Oryza sativa Japonica Group] |
| GenBank | EAY97254.1 | 0 | 2 | 130 | 321 | 458 | hypothetical protein OsI_19173 [Oryza sativa Indica Group] |
| GenBank | EAZ00528.1 | 0 | 1 | 134 | 1 | 134 | hypothetical protein OsI_22547 [Oryza sativa Indica Group] |
| GenBank | EAZ00529.1 | 0 | 2 | 130 | 344 | 481 | hypothetical protein OsI_22548 [Oryza sativa Indica Group] |
| GenBank | EEE65528.1 | 0 | 1 | 134 | 1 | 134 | hypothetical protein OsJ_20981 [Oryza sativa Japonica Group] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 2e-17 | 2 | 128 | 356 | 477 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2acv_B | 3e-16 | 2 | 130 | 335 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acv_A | 3e-16 | 2 | 130 | 335 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acw_B | 3e-16 | 2 | 130 | 335 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acw_A | 3e-16 | 2 | 130 | 335 | 463 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| apigenin glycosides biosynthesis | RXN-5021 | EC-2.4.1.81 | flavone 7-O-β-glucosyltransferase |
| daidzein conjugates interconversion | RXN-3584 | EC-2.4.1.170 | isoflavone 7-O-glucosyltransferase |
| formononetin conjugates interconversion | RXN-4761 | EC-2.4.1.170 | isoflavone 7-O-glucosyltransferase |
| genistein conjugates interconversion | RXN-3581 | EC-2.4.1.170 | isoflavone 7-O-glucosyltransferase |
| luteolin glycosides biosynthesis | FLAVONE-7-O-BETA-GLUCOSYLTRANSFERASE-RXN | EC-2.4.1.81 | flavone 7-O-β-glucosyltransferase |
| maackiain conjugates interconversion | RXN-4319 | EC-2.4.1.170 | isoflavone 7-O-glucosyltransferase |
| medicarpin conjugates interconversion | RXN-4201 | EC-2.4.1.170 | isoflavone 7-O-glucosyltransferase |
