y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os06g17250.1
FamilyGT1
Protein PropertiesLength: 491 Molecular Weight: 51766.2 Isoelectric Point: 6.1422
ChromosomeChromosome/Scaffold: 6 Start: 9991833 End: 9993305
DescriptionUDP-glucosyl transferase 89B1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1394622.9e-37
  GLRLTVVTTPAMAPLILATAAAVHPGGGGGGAISALILPFPSHPAIPAGVDSAKGFPPSLCGKLVVAFAGLRAPLASWARARADTPDRVVAVLSDFFCGW
  MQLLAAELGVPRVVFSPSGVYGAAVMHSLFRVMPRREDENDDESPVGFPDIPGSPAFPWRQMSRMYRAYKEGDEVSDAVMSNFLLNLQSSSFVSNTFGQL
  ERRYLERPLADMGFRRVRAIGPLAPQHDASGNRGGETAVAATELCAWLDQFADRSVVYVSFGSMAQLQPPHAAALAAALERTRVAFVWAAGSHTPLPEGF
  EERAAGGRGTVIRGWAPQVAALRHRAVGWFVTHCGWNSTLEALAAGVTMLAWPMVGEQFVNARLLVDELRAAVPLCWGGVPTPPSADEVARVLEATVAAD
  GGEAGGEWSHVAARVKELAEEAAA
Full Sequence
Protein Sequence     Length: 491     Download
MAPATSGSAA AHVLVIPFPA QGHLIPMLDL VRLLASRGGL RLTVVTTPAM APLILATAAA    60
VHPGGGGGGA ISALILPFPS HPAIPAGVDS AKGFPPSLCG KLVVAFAGLR APLASWARAR    120
ADTPDRVVAV LSDFFCGWMQ LLAAELGVPR VVFSPSGVYG AAVMHSLFRV MPRREDENDD    180
ESPVGFPDIP GSPAFPWRQM SRMYRAYKEG DEVSDAVMSN FLLNLQSSSF VSNTFGQLER    240
RYLERPLADM GFRRVRAIGP LAPQHDASGN RGGETAVAAT ELCAWLDQFA DRSVVYVSFG    300
SMAQLQPPHA AALAAALERT RVAFVWAAGS HTPLPEGFEE RAAGGRGTVI RGWAPQVAAL    360
RHRAVGWFVT HCGWNSTLEA LAAGVTMLAW PMVGEQFVNA RLLVDELRAA VPLCWGGVPT    420
PPSADEVARV LEATVAADGG EAGGEWSHVA ARVKELAEEA AAATREGGSS WVEVDELARE    480
LRELGSEPAR *                                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00164PLN001644.0e-309490521+
PLN03004PLN030044.0e-31127413297+
PLN03007PLN030071.0e-4112481505+
PLN02534PLN025345.0e-421441462+
PLN02863PLN028638.0e-1188436439+
Gene Ontology
GO TermDescription
GO:0005575cellular_component
GO:0008152metabolic process
GO:0016740transferase activity
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD69134.1044842483putative UDP-glycosyltransferase [Oryza sativa Japonica Group]
DDBJBAD69254.1014901490putative UDP-glycosyltransferase [Oryza sativa Japonica Group]
GenBankEAZ00534.1014901490hypothetical protein OsI_22552 [Oryza sativa Indica Group]
GenBankEEE65529.10.000000000000003143143hypothetical protein OsJ_20983 [Oryza sativa Japonica Group]
GenBankEEE65529.1011049069434hypothetical protein OsJ_20983 [Oryza sativa Japonica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A4e-381248110477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B2e-3784817461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A2e-3784817461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acv_B3e-3784817461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A3e-3784817461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT862765268122790
EG631256452124410
HX1351952281774030
EC88898730312970
CT858019168922590
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)