CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os06g51084.2
FamilyGH13
Protein PropertiesLength: 756 Molecular Weight: 86634.7 Isoelectric Point: 6.3797
ChromosomeChromosome/Scaffold: 6 Start: 30897376 End: 30905770
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132085338.4e-28
  LPRIRANNYNTVQLMAIMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHESYFHTGDRGYHK
  LWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHGINKGFTGNYKEYFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVL
  CRPVDEGGVGFDFRLAMAIPDRWIDYLKNKEDRKWSMSEIVQTLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYTGMSDLQPASPTINRGIALQ
  KMIHFITMALGGDGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 756     Download
MVTVVEEVDH LPIYDLDPKL EEFKDHFNYR IKRYLDQKCL IEKHEGGLEE FSKGYLKFGI    60
NTVDGATIYR EWAPAAQEAQ LIGEFNNWNG AKHKMEKDKF GIWSIKISHV NGKPAIPHNS    120
KVKFRFRHGG GAWVDRIPAW IRYATFDASK FGAPYDGVHW DPPACERYVF KHPRPPKPDA    180
PRIYEAHVGM SGEEPEVSTY REFADNVLPR IRANNYNTVQ LMAIMEHSYY ASFGYHVTNF    240
FAVSSRSGTP EDLKYLVDKA HSLGLRVLMD VVHSHASNNV TDGLNGYDVG QNTHESYFHT    300
GDRGYHKLWD SRLFNYANWE VLRFLLSNLR YWMDEFMFDG FRFDGVTSML YHHHGINKGF    360
TGNYKEYFSL DTDVDAIVYM MLANHLMHKL LPEATIVAED VSGMPVLCRP VDEGGVGFDF    420
RLAMAIPDRW IDYLKNKEDR KWSMSEIVQT LTNRRYTEKC IAYAESHDQS IVGDKTIAFL    480
LMDKEMYTGM SDLQPASPTI NRGIALQKMI HFITMALGGD GYLNFMGNEF GHPEWIDFPR    540
EGNNWSYDKC RRQWSLVDTD HLRYKYMNAF DQAMNALEEE FSFLSSSKQI VSDMNEKDKV    600
IVFERGDLVF VFNFHPNKTY KGYKVGCDLP GKYRVALDSD ALVFGGHGRV GHDVDHFTSP    660
EGMPGVPETN FNNRPNSFKV LSPPRTCVAY YRVDEDREEL RRGGAVASGK IVTEYIDVEA    720
TSGETISGGW KGSEKDDCGK KGMKFVFRSS DEDCK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029603.0e-53010784+
PLN03244PLN032442.0e-132114640529+
PLN02960PLN029602.0e-176114640528+
PLN02447PLN0244701720720+
cd11321AmyAc_bac_euk_BE0166572407+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP68993.10175566820starch-branching enzyme 1 [Oryza sativa Japonica Group]
GenBankABL74558.10175564818starch-branching enzyme I [Oryza sativa Japonica Group]
DDBJBAA01584.10175566820branching enzyme [Oryza sativa Japonica Group]
DDBJBAD61713.1017551755putative 1,4-alpha-glucan branching enzyme I precursor [Oryza sativa Japonica Group]
RefSeqNP_001058629.10175566820Os06g0726400 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aml_A017551755A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3amk_A017021702A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B017021702A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A017021702A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D1.00053e-426164619577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO619167614977090
CX1091874473107560
HO794536695136950
HO777638643656950
HO7776384416590.37
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)