| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os07g01380.1 |
| Family | AA2 |
| Protein Properties | Length: 153 Molecular Weight: 15977.6 Isoelectric Point: 10.4062 |
| Chromosome | Chromosome/Scaffold: 7 Start: 239515 End: 240945 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 53 | 144 | 1.6e-23 |
| RRGGCDASVLLSSTHGVGGNNMAERDAPPNRSLRGFVSVQRVKSRLEAACPSTVSCADILALMARDAVLLASGPYWPVPLGRRDGRVSCAAE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 153 Download |
| MAVATVIAAT APELAVVVFN LQPHPPLFGG RRSRCNMSGF VIRGVIHTVT IVRRGGCDAS 60 VLLSSTHGVG GNNMAERDAP PNRSLRGFVS VQRVKSRLEA ACPSTVSCAD ILALMARDAV 120 LLASGPYWPV PLGRRDGRVS CAAEVMSPSN IV* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03030 | PLN03030 | 1.0e-28 | 56 | 145 | 90 | + cationic peroxidase; Provisional | ||
| pfam00141 | peroxidase | 4.0e-32 | 55 | 145 | 92 | + Peroxidase. | ||
| cd00693 | secretory_peroxidase | 1.0e-46 | 56 | 145 | 90 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003824 | catalytic activity |
| GO:0004601 | peroxidase activity |
| GO:0005575 | cellular_component |
| GO:0005618 | cell wall |
| GO:0005634 | nucleus |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACL52390.1 | 8e-37 | 36 | 144 | 63 | 164 | unknown [Zea mays] |
| DDBJ | BAC10402.1 | 0 | 12 | 152 | 12 | 151 | peroxidase 1 precursor-like protein [Oryza sativa Japonica Group] |
| RefSeq | NP_001057469.1 | 4e-36 | 56 | 144 | 75 | 159 | Os06g0306300 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001146942.1 | 8e-37 | 56 | 144 | 80 | 164 | peroxidase 1 [Zea mays] |
| RefSeq | XP_002488879.1 | 2e-36 | 56 | 144 | 75 | 159 | hypothetical protein SORBIDRAFT_2674s002010 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hdl_A | 1e-24 | 56 | 144 | 48 | 133 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1fhf_C | 1e-19 | 56 | 136 | 48 | 125 | A Chain A, The Structure Of Soybean Peroxidase |
| PDB | 1fhf_B | 1e-19 | 56 | 136 | 48 | 125 | A Chain A, The Structure Of Soybean Peroxidase |
| PDB | 1fhf_A | 1e-19 | 56 | 136 | 48 | 125 | A Chain A, The Structure Of Soybean Peroxidase |
| PDB | 1kzm_A | 2e-18 | 55 | 136 | 47 | 125 | A Chain A, Distal Heme Pocket Mutant (r38s/h42e) Of Recombinant Horseradish Peroxidase C (hrp |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CA140979 | 109 | 36 | 144 | 1e-37 |
| DY540958 | 113 | 36 | 148 | 5e-37 |
| CD428559 | 109 | 36 | 144 | 6e-37 |
| CX608318 | 109 | 36 | 144 | 8e-37 |
| CX611470 | 123 | 22 | 144 | 9e-37 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Populus trichocarpa | Potri.007G122000.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |