y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os07g30369.1
FamilyGT1
Protein PropertiesLength: 487 Molecular Weight: 51500.5 Isoelectric Point: 5.0615
ChromosomeChromosome/Scaffold: 7 Start: 17973962 End: 17975551
DescriptionUDP-glucosyl transferase 85A2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12284532.2e-31
  ARAVVLNTAASMEGPALAHVAPRMRDVFAIGPLHAMFPVPAAAGSLWRADDGCVAWLDGQPDRSVVYVSLGSFAVISLEQFTEFLHGLVAAGYPFLWVLR
  PDMVGASQSAGALREAVAAAEKNNKARVVGWAPQRDVLRHRAVGCFLTHAGWNSTLEAAGEGVPTVCWPFFADQQINSRFVGAVWGTGLDMKDVCDAAVV
  ERMVREAMESGEIRASAQALAREVRQ
Full Sequence
Protein Sequence     Length: 487     Download
MAAAAAAAHV LVFPAPGQGH INCMMHFATG LVGAGLHVTF LHTDHSLRRL GGAAAAGGAD    60
SPRLRFMSIP DGLPDDHPRA VGDIVELLES LRTNGSVPYR SLLASLVRAG DDGASSGGFP    120
PVTCVVADGS MPFAADVAEE IGVPSLVFRT ASACSVLAYL SVDRLFELGE VVLFPADGDL    180
DEPVRGVPGM ESFLRRRDLP GNFRNCTEDQ NDPIVQMLIE VTAHSRGARA VVLNTAASME    240
GPALAHVAPR MRDVFAIGPL HAMFPVPAAA GSLWRADDGC VAWLDGQPDR SVVYVSLGSF    300
AVISLEQFTE FLHGLVAAGY PFLWVLRPDM VGASQSAGAL REAVAAAEKN NKARVVGWAP    360
QRDVLRHRAV GCFLTHAGWN STLEAAGEGV PTVCWPFFAD QQINSRFVGA VWGTGLDMKD    420
VCDAAVVERM VREAMESGEI RASAQALARE VRQDVADGGS SAAEFERLVG FIKELSNQHD    480
GQFIQA*                                                              540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02152PLN021529.0e-449475485+
PLN02173PLN021738.0e-479473486+
PLN02555PLN025557.0e-561469506+
PLN02448PLN024488.0e-649477491+
PLN02410PLN024103.0e-7310475471+
Gene Ontology
GO TermDescription
GO:0005575cellular_component
GO:0008152metabolic process
GO:0016740transferase activity
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC57706.1014773467putative glucosyltransferase-2 [Oryza sativa Japonica Group]
GenBankEAZ03904.1014771478hypothetical protein OsI_26038 [Oryza sativa Indica Group]
GenBankEAZ39840.1014861486hypothetical protein OsJ_24281 [Oryza sativa Japonica Group]
RefSeqNP_001059664.1014773467Os07g0486700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001059665.1014861486Os07g0487100 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A044695474A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acv_B3e-3914693458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A3e-3914693458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acw_B3e-3914693458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A3e-3914693458A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
daidzein conjugates interconversionRXN-3584EC-2.4.1.170isoflavone 7-O-glucosyltransferase
formononetin conjugates interconversionRXN-4761EC-2.4.1.170isoflavone 7-O-glucosyltransferase
genistein conjugates interconversionRXN-3581EC-2.4.1.170isoflavone 7-O-glucosyltransferase
maackiain conjugates interconversionRXN-4319EC-2.4.1.170isoflavone 7-O-glucosyltransferase
medicarpin conjugates interconversionRXN-4201EC-2.4.1.170isoflavone 7-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CI1394012082804870
CB64758925792620
EG63124347894740
HX1612362272354610
CT84635324992540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00046.1Aquca_009_00820.1Aquca_009_00819.1Aquca_009_00818.1Aquca_023_00029.1
Aquca_011_00581.1Aquca_011_00592.1Aquca_011_00582.1Aquca_011_00591.1
Arabidopsis lyrata325212916575487386486004872501
867000486005487387496094485042
886188347758485040487389485039
481506494174905874865981865978
865974494179
Arabidopsis thalianaAT5G05870.1AT3G46650.1AT3G46660.1AT5G38010.1AT5G05860.1
AT3G55700.1AT3G55710.1AT5G05880.1AT3G11340.1AT5G05890.1
AT5G59580.1AT3G46670.1AT5G05900.1AT5G59590.1AT3G46680.1
AT3G46700.1AT3G46690.1AT5G38040.1AT3G46720.1AT2G26480.1
Brachypodium distachyonBradi1g53520.1Bradi1g27275.1Bradi4g39370.1Bradi1g27290.1Bradi1g27270.1
Bradi4g12360.1Bradi1g27290.2Bradi1g53560.1Bradi1g53540.1Bradi1g53527.1
Bradi1g53550.1Bradi2g19780.1Bradi4g41410.1Bradi3g15945.1
Brassica rapaBra009143Bra007184Bra002556Bra034848Bra009144
Bra003220Bra009142Bra005869Bra009145Bra009146
Bra033808Bra009147Bra018203Bra020310Bra031102
Bra018201Bra018202Bra000542Bra006707Bra033807
Carica papayaevm.model.supercontig_19.246evm.model.supercontig_81.42evm.model.supercontig_81.31evm.model.supercontig_81.38evm.model.supercontig_81.29
evm.model.supercontig_19.242evm.model.supercontig_19.243evm.model.supercontig_19.244evm.model.supercontig_19.245evm.model.supercontig_81.40
evm.model.supercontig_81.32evm.model.supercontig_81.46evm.TU.contig_40501.1
Capsella rubellaCarubv10025043mCarubv10019445mCarubv10017158mCarubv10019480mCarubv10017212m
Carubv10013696mCarubv10000929mCarubv10000926mCarubv10018552mCarubv10026384m
Carubv10027963mCarubv10017233mCarubv10017284mCarubv10017253mCarubv10017240m
Carubv10018900mCarubv10019422mCarubv10018747mCarubv10017421m
Citrus clementinaCiclev10031408mCiclev10031368mCiclev10031404mCiclev10013877mCiclev10030404m
Ciclev10011602mCiclev10028405mCiclev10030812m.58.219Ciclev10030812m.58.219Ciclev10030803m.58.219
Ciclev10030803m.58.219Ciclev10001065mCiclev10004935mCiclev10030812m.508.702Ciclev10030812m.508.702
Ciclev10030803m.513.707Ciclev10030803m.513.707Ciclev10028392mCiclev10020064mCiclev10030245m
Ciclev10028300mCiclev10028422mCiclev10028419mCiclev10027296mCiclev10028437m
Ciclev10028217mCiclev10003724m
Citrus sinensisorange1.1g011832morange1.1g048753morange1.1g012587morange1.1g011848morange1.1g037374m
orange1.1g037999morange1.1g011792morange1.1g044936morange1.1g011531morange1.1g024869m
orange1.1g013342morange1.1g012735morange1.1g040486morange1.1g012678morange1.1g012474m
orange1.1g012543morange1.1g012563morange1.1g012151morange1.1g012613morange1.1g020179m
orange1.1g018483morange1.1g014232morange1.1g046167morange1.1g013836morange1.1g016062m
Cucumis sativusCucsa.164750.1Cucsa.164740.1Cucsa.164800.1Cucsa.164720.1Cucsa.066730.1
Cucsa.146680.1Cucsa.136380.1Cucsa.068420.1Cucsa.146660.1Cucsa.146670.1
Eucalyptus grandisEucgr.B02292.1Eucgr.G03009.1Eucgr.G03014.1Eucgr.A00424.1Eucgr.G03013.1
Eucgr.G03010.1Eucgr.J00979.1Eucgr.J00976.1Eucgr.J00977.1Eucgr.B02744.1
Eucgr.L02290.1Eucgr.J00970.1Eucgr.G03006.1Eucgr.J01973.1Eucgr.G03007.1
Eucgr.J01968.1Eucgr.J00972.1Eucgr.B02291.1Eucgr.J01967.1Eucgr.J01971.1
Eucgr.J01963.1Eucgr.J01962.1Eucgr.J00971.1
Fragaria vescamrna18747.1-v1.0-hybridmrna34103.1-v1.0-hybridmrna34102.1-v1.0-hybrid
Glycine maxGlyma01g02670.1Glyma01g02740.2Glyma03g16250.1Glyma03g16310.1Glyma03g16296.1
Glyma11g34720.1Glyma11g34730.1Glyma11g14260.2Glyma12g06221.1
Gossypium raimondiiGorai.001G113300.1Gorai.011G275800.1Gorai.011G274800.1Gorai.011G275600.1Gorai.011G275700.1
Gorai.011G275300.1Gorai.011G275300.2Gorai.011G275100.3Gorai.011G275100.2Gorai.011G275100.1
Gorai.011G275400.4Gorai.011G275400.2Gorai.011G275400.1Gorai.011G275400.3Gorai.011G275000.1
Gorai.012G074100.1Gorai.011G275200.1Gorai.012G109200.4Gorai.012G109200.3Gorai.012G109200.2
Gorai.012G109200.1Gorai.011G274700.1Gorai.012G073900.1Gorai.009G321100.1Gorai.001G113200.1
Gorai.001G113900.1Gorai.001G113800.1Gorai.001G114000.1
Linum usitatissimumLus10016459Lus10004670Lus10017201Lus10014831Lus10009876
Lus10037268Lus10040246Lus10004671Lus10004672Lus10040725
Lus10016460Lus10016461Lus10004673Lus10035681
Malus domesticaMDP0000234251MDP0000168272MDP0000771573MDP0000096923MDP0000293001
MDP0000673553MDP0000651396MDP0000390437MDP0000630319MDP0000288886
MDP0000299496MDP0000375039MDP0000791553MDP0000705244MDP0000292949
MDP0000523619MDP0000601017MDP0000202898MDP0000196394MDP0000240663
MDP0000304625MDP0000551467MDP0000255642MDP0000708060MDP0000123636
MDP0000172043MDP0000591257MDP0000671121
Manihot esculentacassava4.1_007674mcassava4.1_006281mcassava4.1_006726mcassava4.1_021325mcassava4.1_007065m
cassava4.1_029835mcassava4.1_031775mcassava4.1_028931mcassava4.1_027442mcassava4.1_026577m
Medicago truncatulaMedtr5g031840.1Medtr5g031830.1Medtr5g031860.1Medtr3g069690.1Medtr3g069710.1
Medtr6g014160.1
Mimulus guttatusmgv1a023633mmgv1a005050mmgv1a005720mmgv1a005336m
Oryza sativaLOC_Os07g30610.1LOC_Os07g14630.1LOC_Os11g25454.1LOC_Os07g13770.1LOC_Os07g30760.1
LOC_Os07g30469.1LOC_Os07g30620.1LOC_Os07g30690.1LOC_Os07g30330.1LOC_Os09g03140.1
LOC_Os07g13800.1LOC_Os07g13634.1LOC_Os03g60960.1LOC_Os07g13660.1LOC_Os07g13810.1
LOC_Os07g42970.1
Panicum virgatumPavirv00034964mPavirv00070665mPavirv00005440mPavirv00018266mPavirv00016972m
Pavirv00015728mPavirv00026421mPavirv00026178mPavirv00024746mPavirv00068805m
Pavirv00040191mPavirv00009136mPavirv00042788mPavirv00010936mPavirv00059965m
Pavirv00020520mPavirv00041610mPavirv00064634mPavirv00065860mPavirv00056851m
Pavirv00007059mPavirv00021384mPavirv00048201mPavirv00001378mPavirv00051012m
Pavirv00066800mPavirv00048212mPavirv00025068mPavirv00058575mPavirv00032551m
Pavirv00000131m
Phaseolus vulgarisPhvul.002G145900.1Phvul.002G146200.1Phvul.002G146100.1Phvul.010G001300.1Phvul.010G009000.1
Phvul.011G060300.1Phvul.001G238800.1Phvul.001G238900.1
Populus trichocarpaPotri.008G062400.2Potri.008G062400.1Potri.016G105400.1Potri.016G105300.1Potri.010G195600.1
Potri.010G195300.1Potri.010G195500.1Potri.009G039000.2Potri.009G039000.1Potri.001G245900.1
Potri.006G039300.1
Prunus persicappa025605mppa005447mppa016769mppa019804mppa022102m
ppa025141mppa005539mppa016206mppa005623mppa005624m
ppa017124mppa018563mppa020483mppa019614mppa020431m
ppa016568m
Ricinus communis29610.m00038929610.m00039029751.m00183029751.m00182829790.m000840
Setaria italicaSi013725mSi013705mSi032617mSi029738mSi032476m
Si029654mSi024741mSi029672mSi029739mSi029735m
Si029711mSi033228mSi029813mSi029803mSi035560m
Si032090mSi029717mSi035584mSi035523mSi035261m
Si029630mSi033128mSi032122mSi015361mSi017426m
Sorghum bicolorSb09g028320.2Sb09g028320.1Sb02g007090.1Sb02g007100.1Sb02g007140.1
Sb02g033580.1Sb02g033570.1Sb02g007110.1Sb02g007080.1Sb01g002890.1
Sb01g002870.1Sb01g002860.1Sb02g007150.1Sb10g028810.1Sb02g007260.1
Thellungiella halophilaThhalv10010354mThhalv10013505mThhalv10002769mThhalv10003055mThhalv10020723m
Thhalv10011136mThhalv10013513mThhalv10013500mThhalv10013508mThhalv10007597m
Thhalv10002845mThhalv10015913mThhalv10002978mThhalv10003098mThhalv10002974m
Vitis viniferaGSVIVT01016422001GSVIVT01033638001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)