y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os07g40740.1
FamilyGH79
Protein PropertiesLength: 530 Molecular Weight: 56219.7 Isoelectric Point: 8.5578
ChromosomeChromosome/Scaffold: 7 Start: 24417383 End: 24419441
Descriptionglucuronidase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79475210
  DDNFVCATLDWWPRDKCNYGMCPWYNASIINLDLNNTILNNAVKAFNSLRIRLGGSLQDQVTYKVGSNYGDCRSFQRDDGGLFGFTDGCLEMNRWDELNV
  FFKRTNTTVTFGLNALKGRRKAAGGKDTLYSGDWDARNALDLMRYTAGKGYRVESWELGNELSGSGVAARVAAAQYGRDVAVLRKAVERVYGGGGEVPKV
  LAPGGFYDGAWFSEMLRVSGRGAVDGVTHHIYNLGSGKDRDLARKMQDPGYLDQVEKTFRDMAATVRGSGPWSSPWVGESGGAYNSGGKGVSDRYVNGFW
  YLDQLGMSAAHGTRVYCRQALVGGNYCLLNTTTFVPNPDYYGALLWHRLMGPVVLKAATTAGGGGSPYLRSYAHCSREKPGVTVLLINLSNATAFDVSVA
  GGALGAAPCGGRREEYHLSPLGGDIRSQVVLLNGEALALGPGGEIPELRPAVVGDGCAAPLRVAARGIAFVRFTE
Full Sequence
Protein Sequence     Length: 530     Download
MAAVLPLLAA ALLVLFSGLH PAASTAAAGG EAATVVVKAA AAVSRTDDNF VCATLDWWPR    60
DKCNYGMCPW YNASIINLDL NNTILNNAVK AFNSLRIRLG GSLQDQVTYK VGSNYGDCRS    120
FQRDDGGLFG FTDGCLEMNR WDELNVFFKR TNTTVTFGLN ALKGRRKAAG GKDTLYSGDW    180
DARNALDLMR YTAGKGYRVE SWELGNELSG SGVAARVAAA QYGRDVAVLR KAVERVYGGG    240
GEVPKVLAPG GFYDGAWFSE MLRVSGRGAV DGVTHHIYNL GSGKDRDLAR KMQDPGYLDQ    300
VEKTFRDMAA TVRGSGPWSS PWVGESGGAY NSGGKGVSDR YVNGFWYLDQ LGMSAAHGTR    360
VYCRQALVGG NYCLLNTTTF VPNPDYYGAL LWHRLMGPVV LKAATTAGGG GSPYLRSYAH    420
CSREKPGVTV LLINLSNATA FDVSVAGGAL GAAPCGGRRE EYHLSPLGGD IRSQVVLLNG    480
EALALGPGGE IPELRPAVVG DGCAAPLRVA ARGIAFVRFT EFKAPACAA*               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03662Glyco_hydro_79n4.0e-14346352307+
Gene Ontology
GO TermDescription
GO:0005623cell
GO:0008152metabolic process
GO:0016020membrane
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ04591.1015291529hypothetical protein OsI_26741 [Oryza sativa Indica Group]
GenBankEEE67528.101652916490hypothetical protein OsJ_24994 [Oryza sativa Japonica Group]
RefSeqNP_001060182.1015291529Os07g0598400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002315010.102552818518predicted protein [Populus trichocarpa]
RefSeqXP_002512114.103152629529Heparanase precursor, putative [Ricinus communis]
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK266509307913970
HO7970313751845290
GO873410324453680
GO8753203351114450
FQ4300982851504340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G61250.1AT5G34940.3
AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna26075.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma13g23190.1Glyma17g11670.1
Glyma04g32745.2Glyma04g32745.1Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2
Glyma06g21551.1Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2
Glyma02g12740.2Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi016855mSi006147mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)