y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os07g49360.1
FamilyAA2
Protein PropertiesLength: 332 Molecular Weight: 36295.2 Isoelectric Point: 7.6852
ChromosomeChromosome/Scaffold: 7 Start: 29561180 End: 29562535
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2493100
  EVRRLYEEHGNTAVSWLRALFHDCMVYSCDASLLLHTTTTTGVSEQSSHRSFGMRNFKYITAIKAAVERECPATVSCADILALAARDGVAMLGGPSVAMR
  TGRRDSRESYYGVVEQYIPNHNDSVSTVLSRFAAIGVDTEGAVALLGAHSVGRVHCFNLVGRLYPQVDGSMEAAYGEYLRGRCPTAAATEDTREVVYARN
  DRVTPMLIDNMYYRNLLAGRGLLLVDQQLASDARTAPYVRRMAADNDYFHQRFAAALLTMSE
Full Sequence
Protein Sequence     Length: 332     Download
MMRRSLVIVM VACSCATAIA RGGGGGGLKL NFYSESERCP RAEEVVREEV RRLYEEHGNT    60
AVSWLRALFH DCMVYSCDAS LLLHTTTTTG VSEQSSHRSF GMRNFKYITA IKAAVERECP    120
ATVSCADILA LAARDGVAML GGPSVAMRTG RRDSRESYYG VVEQYIPNHN DSVSTVLSRF    180
AAIGVDTEGA VALLGAHSVG RVHCFNLVGR LYPQVDGSME AAYGEYLRGR CPTAAATEDT    240
REVVYARNDR VTPMLIDNMY YRNLLAGRGL LLVDQQLASD ARTAPYVRRM AADNDYFHQR    300
FAAALLTMSE NAPLTGAQGE VRKDCRFVNS S*                                  360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase2.0e-626229332+
cd00314plant_peroxidase_like1.0e-2063310264+
pfam00141peroxidase4.0e-4357199144+
PLN03030PLN030305.0e-4565329277+
cd00693secretory_peroxidase5.0e-12128328306+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004601peroxidase activity
GO:0005488binding
GO:0005515protein binding
GO:0005829cytosol
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC84057.1023311330putative peroxidase [Oryza sativa Japonica Group]
DDBJBAF22651.20733311259Os07g0694300 [Oryza sativa Japonica Group]
GenBankEAZ05247.1023251326hypothetical protein OsI_27449 [Oryza sativa Indica Group]
GenBankEAZ27428.1023201319hypothetical protein OsJ_11374 [Oryza sativa Japonica Group]
RefSeqNP_001060737.10373311295Os07g0694300 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0283313306A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1pa2_A0283313306A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B0253311307A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A0253311307A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB3hdl_A0283302304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HS090357274573300
JG699096274573300
DR740664294283190
EG396023233572870
EX034412278573320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)