| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os07g49400.3 |
| Family | AA2 |
| Protein Properties | Length: 201 Molecular Weight: 21500.3 Isoelectric Point: 6.7881 |
| Chromosome | Chromosome/Scaffold: 7 Start: 29583717 End: 29586352 |
| Description | ascorbate peroxidase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 29 | 195 | 0 |
| AEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPP EGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTLGRCHKERSGFEGAWTSNPLIFDNSYFTCV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 201 Download |
| MGSKSYPTVS DEYLAAVGKA KRKLRGLIAE KNCAPLMLRL AWHSAGTFDV SSRTGGPFGT 60 MKNPGEQSHA ANAGLDIAVR LLDPIKDQLP ILSYADFYQL AGVVAVEVTG GPEVPFHPGR 120 QDKPEPPPEG RLPDATQGSD HLRQVFSAQM GLSDKDIVAL SGGHTLGRCH KERSGFEGAW 180 TSNPLIFDNS YFTCVISDSF * 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00141 | peroxidase | 2.0e-44 | 27 | 165 | 148 | + Peroxidase. | ||
| PLN02608 | PLN02608 | 7.0e-105 | 7 | 192 | 186 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 9.0e-112 | 6 | 193 | 192 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| PLN02879 | PLN02879 | 2.0e-112 | 1 | 197 | 197 | + L-ascorbate peroxidase | ||
| PLN02364 | PLN02364 | 3.0e-114 | 3 | 197 | 195 | + L-ascorbate peroxidase 1 | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0000003 | reproduction |
| GO:0003824 | catalytic activity |
| GO:0004601 | peroxidase activity |
| GO:0005515 | protein binding |
| GO:0005575 | cellular_component |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAL08496.1 | 0 | 1 | 197 | 1 | 197 | ascorbate peroxidase [Hordeum vulgare subsp. vulgare] |
| GenBank | ACF87724.1 | 0 | 4 | 197 | 3 | 196 | unknown [Zea mays] |
| GenBank | ACG41151.1 | 0 | 4 | 197 | 3 | 196 | APx2 - Cytosolic Ascorbate Peroxidase [Zea mays] |
| RefSeq | NP_001060741.1 | 0 | 1 | 197 | 1 | 197 | Os07g0694700 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002463451.1 | 0 | 4 | 197 | 3 | 196 | hypothetical protein SORBIDRAFT_02g044060 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2xj6_A | 0 | 4 | 197 | 2 | 195 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
| PDB | 2xih_A | 0 | 4 | 197 | 2 | 195 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
| PDB | 2xif_A | 0 | 4 | 197 | 2 | 195 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
| PDB | 2xi6_A | 0 | 4 | 197 | 2 | 195 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
| PDB | 2vcf_X | 0 | 4 | 197 | 14 | 207 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
| L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
| L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BF430646 | 197 | 1 | 197 | 0 |
| CK068054 | 197 | 1 | 197 | 0 |
| CK053208 | 196 | 2 | 197 | 0 |
| CK070436 | 197 | 1 | 197 | 0 |
| CK068432 | 193 | 1 | 193 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
