y
Basic Information | |
---|---|
Species | Oryza sativa |
Cazyme ID | LOC_Os07g49400.4 |
Family | AA2 |
Protein Properties | Length: 175 Molecular Weight: 18601.2 Isoelectric Point: 6.6801 |
Chromosome | Chromosome/Scaffold: 7 Start: 29583717 End: 29586352 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 29 | 166 | 0 |
AEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPP EGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTL |
Full Sequence |
---|
Protein Sequence Length: 175 Download |
MGSKSYPTVS DEYLAAVGKA KRKLRGLIAE KNCAPLMLRL AWHSAGTFDV SSRTGGPFGT 60 MKNPGEQSHA ANAGLDIAVR LLDPIKDQLP ILSYADFYQL AGVVAVEVTG GPEVPFHPGR 120 QDKPEPPPEG RLPDATQGSD HLRQVFSAQM GLSDKDIVAL SGGHTLMPQG EIWL* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 1.0e-44 | 27 | 165 | 148 | + Peroxidase. | ||
PLN02608 | PLN02608 | 7.0e-84 | 7 | 166 | 160 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 2.0e-87 | 6 | 166 | 165 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02879 | PLN02879 | 1.0e-88 | 1 | 166 | 166 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 2.0e-91 | 3 | 166 | 164 | + L-ascorbate peroxidase 1 |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0000003 | reproduction |
GO:0003824 | catalytic activity |
GO:0004601 | peroxidase activity |
GO:0005515 | protein binding |
GO:0005575 | cellular_component |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAL08496.1 | 0 | 1 | 166 | 1 | 166 | ascorbate peroxidase [Hordeum vulgare subsp. vulgare] |
GenBank | ACF87724.1 | 0 | 4 | 166 | 3 | 165 | unknown [Zea mays] |
GenBank | ACG41151.1 | 0 | 4 | 166 | 3 | 165 | APx2 - Cytosolic Ascorbate Peroxidase [Zea mays] |
RefSeq | NP_001060741.1 | 0 | 1 | 166 | 1 | 166 | Os07g0694700 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002463451.1 | 0 | 4 | 166 | 3 | 165 | hypothetical protein SORBIDRAFT_02g044060 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2xj6_A | 0 | 4 | 166 | 2 | 164 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
PDB | 2xih_A | 0 | 4 | 166 | 2 | 164 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
PDB | 2xif_A | 0 | 4 | 166 | 2 | 164 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2xi6_A | 0 | 4 | 166 | 2 | 164 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2cl4_X | 0 | 4 | 166 | 14 | 176 | X Chain X, Ascorbate Peroxidase R172a Mutant |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FG949549 | 177 | 1 | 175 | 0 |
CK008353 | 166 | 1 | 166 | 0 |
CK067729 | 166 | 1 | 166 | 0 |
CK072499 | 166 | 1 | 166 | 0 |
CK070441 | 166 | 1 | 166 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |