y
Basic Information | |
---|---|
Species | Oryza sativa |
Cazyme ID | LOC_Os08g04460.2 |
Family | AA6 |
Protein Properties | Length: 137 Molecular Weight: 14779 Isoelectric Point: 5.1487 |
Chromosome | Chromosome/Scaffold: 8 Start: 2182687 End: 2184807 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 4 | 126 | 0 |
KIYIVYYSMYGHVAKLAEEIEKGASSVEGVEVKLWQVPETLSDDVLTKMGAPSKKDVPIITPAELAEADGVIFGFPTRFGMMAAQFKAFMDATGGLWRTQ QLAGKPAGIFYSTGSQGGGQETT |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
MAAKIYIVYY SMYGHVAKLA EEIEKGASSV EGVEVKLWQV PETLSDDVLT KMGAPSKKDV 60 PIITPAELAE ADGVIFGFPT RFGMMAAQFK AFMDATGGLW RTQQLAGKPA GIFYSTGSQG 120 GGQETTPRVH LWCWDV* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00258 | Flavodoxin_1 | 2.0e-9 | 7 | 113 | 117 | + Flavodoxin. | ||
pfam03358 | FMN_red | 4.0e-11 | 17 | 113 | 102 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 7.0e-24 | 1 | 113 | 120 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 1.0e-36 | 3 | 113 | 111 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 2.0e-45 | 3 | 113 | 111 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0000166 | nucleotide binding |
GO:0003824 | catalytic activity |
GO:0005575 | cellular_component |
GO:0005886 | plasma membrane |
GO:0006139 | nucleobase-containing compound metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABN12320.1 | 0 | 1 | 127 | 1 | 127 | benzoquinone reductase [Gossypium hirsutum] |
GenBank | ACJ11729.1 | 0 | 1 | 127 | 1 | 127 | benzoquinone reductase [Gossypium hirsutum] |
GenBank | ACU13985.1 | 0 | 1 | 126 | 1 | 126 | unknown [Glycine max] |
RefSeq | NP_001060966.1 | 0 | 1 | 127 | 1 | 127 | Os08g0139200 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002518592.1 | 0 | 1 | 127 | 1 | 127 | Flavoprotein wrbA, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 1e-34 | 3 | 126 | 2 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 1e-34 | 3 | 126 | 2 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 1e-34 | 3 | 126 | 2 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_A | 1e-34 | 3 | 126 | 2 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6j_B | 1e-34 | 3 | 126 | 2 | 123 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CX107948 | 137 | 1 | 137 | 0 |
CX105486 | 137 | 1 | 137 | 0 |
CI683592 | 114 | 1 | 114 | 0 |
CI687648 | 114 | 1 | 114 | 0 |
CI682835 | 114 | 1 | 114 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |