y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os08g12410.1
FamilyCE8
Protein PropertiesLength: 395 Molecular Weight: 43434.1 Isoelectric Point: 7.2638
ChromosomeChromosome/Scaffold: 8 Start: 7325121 End: 7327754
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8763750
  AVVAADGTGQYTTIKQAVKAAEADTSGRRYTIHVKAGKYVEDVEIWRPNITMIGDGIGRTIISGMKSKNKNRGTACTGTLNVQKDGFIARELTVENTAGP
  QAMQAAAVVVKSDRAVFFRCEITGYQDTLLADVYRQFYRECVISGTIDFVWGEATAVFQMCHLLVRRPLEGSHNTITAQGRNHSEPVVARSGFVFQECNV
  STKEDLRGVDTYLGRPWHPDSRVIFMSSYLDGNVVNPKGWVAWRINNATDERSTASTVYYAEYNNTGAGANVTQRVNWHGFHLLAPHEVRNFTVDSFIDG
Full Sequence
Protein Sequence     Length: 395     Download
MKQYYKAALL RYWVVVPFLL WLVATEEQLA AGAVAGAAAE SSSTWGGQGQ LQLPLWVRPG    60
DRRLLGMSVA GMAVDAVVAA DGTGQYTTIK QAVKAAEADT SGRRYTIHVK AGKYVEDVEI    120
WRPNITMIGD GIGRTIISGM KSKNKNRGTA CTGTLNVQKD GFIARELTVE NTAGPQAMQA    180
AAVVVKSDRA VFFRCEITGY QDTLLADVYR QFYRECVISG TIDFVWGEAT AVFQMCHLLV    240
RRPLEGSHNT ITAQGRNHSE PVVARSGFVF QECNVSTKED LRGVDTYLGR PWHPDSRVIF    300
MSSYLDGNVV NPKGWVAWRI NNATDERSTA STVYYAEYNN TGAGANVTQR VNWHGFHLLA    360
PHEVRNFTVD SFIDGGSWLP ETNVPYHLDL DLGL*                               420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02468PLN024681.0e-9452390343+
PLN02314PLN023142.0e-9552390346+
PLN02745PLN027453.0e-10053390345+
PLN02201PLN022016.0e-10349386348+
pfam01095Pectinesterase3.0e-11885375298+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0008150biological_process
GO:0008152metabolic process
GO:0016787hydrolase activity
GO:0030234enzyme regulator activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ06024.1013941397hypothetical protein OsI_28269 [Oryza sativa Indica Group]
GenBankEEE68246.102353941160hypothetical protein OsJ_26449 [Oryza sativa Japonica Group]
RefSeqNP_001061267.1013941394Os08g0220400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001147569.1054390210557pectinesterase PPE8B [Zea mays]
RefSeqXP_002444448.1054386238578hypothetical protein SORBIDRAFT_07g022090 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A0753908319A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0753864311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B4e-23733496315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A4e-23733496315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B4e-23733496315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
724
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK042794196232180
DY3615292871123940
DY946604293963860
DY948282295983900
EL4193382851073900
Orthologous Group
SpeciesID
Oryza sativaLOC_Os11g36240.1
Panicum virgatumPavirv00057340m
Setaria italicaSi022417mSi019968mSi025266m.144.297Si025266m.144.297
Sorghum bicolorSb05g000900.1Sb04g037740.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny