y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os08g20420.1
FamilyGT28
Protein PropertiesLength: 395 Molecular Weight: 44644.6 Isoelectric Point: 9.2602
ChromosomeChromosome/Scaffold: 8 Start: 12266091 End: 12269671
Descriptionmonogalactosyldiacylglycerol synthase type C
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282033611.2e-31
  VLLMGGGEGMGPVEETARALSDELYDRRRRRPVGQIVVICGRNQVLRSTLQSSRWNVPVKIRGFEKQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN
  DFIPGQEVGNVPYVVDNGAGVFSKDPREAARQVARWFTTHTNELRRYSLNALKLAQPEA
Full Sequence
Protein Sequence     Length: 395     Download
MSDTGGGHRA SAEALRDAFR LEFGDAYQVF VRDLGKEYGG WPLNDMERSY KFMIRHVRLW    60
KVAFHGTSPR WVHGMYLAAL AYFYANEVVA GIMRYNPDII ISVHPLMQHI PLWVLKWQSL    120
HPKVPFVTVI TDLNTCHPTW FHHGVTRCYC PSAEVAKRAL LRGLEPSQIR VYGLPIRPSF    180
CRAVLDKDEL RKELDMDPDL PAVLLMGGGE GMGPVEETAR ALSDELYDRR RRRPVGQIVV    240
ICGRNQVLRS TLQSSRWNVP VKIRGFEKQM EKWMGACDCI ITKAGPGTIA EALIRGLPII    300
LNDFIPGQEV GNVPYVVDNG AGVFSKDPRE AARQVARWFT THTNELRRYS LNALKLAQPE    360
AVFDIVKDIH KLQQQPATVT RIPYSLTSSF SYSI*                               420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG2.0e-215367387+
PRK13608PRK136081.0e-3382375302+
PRK13609PRK136095.0e-355374382+
pfam06925MGDG_synth6.0e-738176169+
PLN02605PLN0260501376378+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0006629lipid metabolic process
GO:0006950response to stress
GO:0007154cell communication
GO:0008152metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtA2YTP90139476469MGDG2_ORYSI RecName: Full=Probable monogalactosyldiacylglycerol synthase 2, chloroplastic; Short=OsMGD2; Flags: Precursor
DDBJBAD30710.1013941394putative MGDG synthase type A [Oryza sativa Japonica Group]
GenBankEEC83316.1013941394hypothetical protein OsI_28698 [Oryza sativa Indica Group]
RefSeqNP_001061487.10139415408Os08g0299400 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ6UTZ20139476469MGDG2_ORYSJ RecName: Full=Probable monogalactosyldiacylglycerol synthase 2, chloroplastic; Short=OsMGD2; Flags: Precursor
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT339279296553500
GO845052302923930
CJ672079275333070
EX529759308473540
HO46647737513750
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)