| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os09g26770.3 |
| Family | GT2 |
| Protein Properties | Length: 350 Molecular Weight: 39241.1 Isoelectric Point: 9.2325 |
| Chromosome | Chromosome/Scaffold: 9 Start: 16259678 End: 16265914 |
| Description | Nucleotide-diphospho-sugar transferases superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT2 | 188 | 311 | 3.9e-24 |
| IDWARKEINIKYEIRDNRKGYKAGALKKGMEHIYTQQCDFVAIFDADFQPESDFLLKIIPFLVHNPKIGLVQTRWEFVNYDVCLMTRIQKMSLDYHFKVE QESGSSMHSFFGFNGTAAVWRVSA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 350 Download |
| MASLRAATGL PFSPRPACCR PPSSPGSRRG FVFPPRFAPG VFLFFPLDSA GGGGVARRRA 60 YPRIEATARH GARKENPKVR NRRLQKKFNG TATKPRLSVF CSNRQLYAML VDDHNKKILF 120 YGSTLQKAIC GDPPCGAVEA AGRIGEELIR ACKELDITEI SSYDRNGFAR GEKMMAFEVP 180 DLVELECIDW ARKEINIKYE IRDNRKGYKA GALKKGMEHI YTQQCDFVAI FDADFQPESD 240 FLLKIIPFLV HNPKIGLVQT RWEFVNYDVC LMTRIQKMSL DYHFKVEQES GSSMHSFFGF 300 NGTAAVWRVS ATINEAGGWK DHTTVEDMDL AVRLYGQASR DGNSCMLVI* 360 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK05593 | rplR | 1.0e-18 | 73 | 168 | 96 | + 50S ribosomal protein L18; Reviewed | ||
| cd06421 | CESA_CelA_like | 2.0e-20 | 192 | 336 | 146 | + CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end. | ||
| cd06423 | CESA_like | 3.0e-22 | 186 | 327 | 142 | + CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan. | ||
| cd00432 | Ribosomal_L18_L5e | 4.0e-24 | 85 | 177 | 94 | + Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA depends on the binding of L18 and L5 to 5S rRNA. L18/L5e is generally described as L18 in prokaryotes and archaea, and as L5e (or L5) in eukaryotes. In bacteria, the CP proteins L5, L18, and L25 are required for the ribosome to incorporate 5S rRNA into the large subunit, one of the last steps in ribosome assembly. In archaea, both L18 and L5 bind 5S rRNA; in eukaryotes, only the L18 homolog (L5e) binds 5S rRNA but a homolog to L5 is also identified. | ||
| cd06437 | CESA_CaSu_A2 | 3.0e-74 | 178 | 333 | 156 | + Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003735 | structural constituent of ribosome |
| GO:0005622 | intracellular |
| GO:0005840 | ribosome |
| GO:0006412 | translation |
| GO:0008150 | biological_process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABF94194.1 | 0 | 179 | 333 | 157 | 310 | glycosyl transferase family 2 protein, putative, expressed [Oryza sativa (japonica cultivar-group)] |
| DDBJ | BAD36080.1 | 0 | 1 | 180 | 1 | 157 | ribosomal protein-like [Oryza sativa Japonica Group] |
| GenBank | EEC84639.1 | 0 | 1 | 334 | 1 | 334 | hypothetical protein OsI_31516 [Oryza sativa Indica Group] |
| GenBank | EEE69790.1 | 0 | 1 | 334 | 1 | 349 | hypothetical protein OsJ_29510 [Oryza sativa Japonica Group] |
| Swiss-Prot | Q8S7W0 | 0 | 179 | 333 | 157 | 310 | CSLA4_ORYSJ RecName: Full=Probable mannan synthase 4; AltName: Full=Cellulose synthase-like protein A4; AltName: Full=OsCslA4 |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3bbo_Q | 0.000000000000001 | 60 | 168 | 33 | 141 | R Chain R, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome |
| PDB | 1ovy_A | 0.00000000007 | 78 | 168 | 12 | 100 | A Chain A, Solution Structure Of Ribosomal Protein L18 From Bacillus Stearothermophilus |
| PDB | 4hg6_A | 0.0000000001 | 193 | 337 | 210 | 353 | B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CK053228 | 153 | 193 | 345 | 0 |
| JG813051 | 155 | 179 | 333 | 0 |
| CI145992 | 149 | 32 | 180 | 0 |
| CI122709 | 149 | 32 | 180 | 0 |
| CV099939 | 155 | 179 | 333 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
