y
Basic Information | |
---|---|
Species | Oryza sativa |
Cazyme ID | LOC_Os10g01760.1 |
Family | AA2 |
Protein Properties | Length: 178 Molecular Weight: 18367.8 Isoelectric Point: 4.4409 |
Chromosome | Chromosome/Scaffold: 10 Start: 488939 End: 489472 |
Description | Peroxidase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 73 | 159 | 8.5e-25 |
DPRIPASLIRLHFHDCFVNGCDASILLDEDLPSGIHTEKRVPANDNSARGFDVVDDIKCELDKACPGVVSCADILAIAAQVSVDLVG |
Full Sequence |
---|
Protein Sequence Length: 178 Download |
MAAPASSTSS LLLVLVILLA AALISHSSAN AWPASSSGSG GGGGGLSAGF YDETCPSAQD 60 VVRRVIQDAR VADPRIPASL IRLHFHDCFV NGCDASILLD EDLPSGIHTE KRVPANDNSA 120 RGFDVVDDIK CELDKACPGV VSCADILAIA AQVSVDLVGV NLFIEHTSLL SNSLYYS* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 2.0e-11 | 60 | 160 | 109 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN03030 | PLN03030 | 1.0e-34 | 50 | 157 | 108 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 5.0e-35 | 62 | 159 | 98 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 2.0e-54 | 50 | 159 | 110 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003824 | catalytic activity |
GO:0004601 | peroxidase activity |
GO:0005488 | binding |
GO:0005773 | vacuole |
GO:0006950 | response to stress |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAG12487.1 | 0 | 1 | 177 | 1 | 177 | Putative peroxidase [Oryza sativa Japonica Group] |
EMBL | CAH69366.1 | 0 | 1 | 159 | 1 | 159 | TPA: class III peroxidase 124 precursor [Oryza sativa (japonica cultivar-group)] |
GenBank | EAY77477.1 | 0 | 1 | 159 | 1 | 160 | hypothetical protein OsI_32519 [Oryza sativa Indica Group] |
GenBank | EAZ15071.1 | 0 | 1 | 153 | 1 | 153 | hypothetical protein OsJ_30481 [Oryza sativa Japonica Group] |
RefSeq | XP_002439838.1 | 0 | 41 | 159 | 39 | 156 | hypothetical protein SORBIDRAFT_09g020980 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1qo4_A | 9.99967e-42 | 46 | 159 | 3 | 114 | A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc |
PDB | 1pa2_A | 9.99967e-42 | 46 | 159 | 3 | 114 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 4a5g_B | 8.99998e-41 | 43 | 159 | 1 | 115 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 4a5g_A | 8.99998e-41 | 43 | 159 | 1 | 115 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 1gx2_B | 3e-36 | 46 | 159 | 3 | 114 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
Transmembrane Domains | ||||
---|---|---|---|---|
Start | End | |||
7 | 29 |
Signal Peptide | ||||
---|---|---|---|---|
Cleavage Site | ||||
29 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GR351557 | 110 | 50 | 159 | 0 |
GR345773 | 110 | 50 | 159 | 0 |
CA141061 | 110 | 50 | 159 | 0 |
CD208606 | 107 | 50 | 156 | 0 |
CJ692207 | 110 | 50 | 159 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|