y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os10g18530.1
FamilyGT1
Protein PropertiesLength: 234 Molecular Weight: 25769.6 Isoelectric Point: 6.1427
ChromosomeChromosome/Scaffold: 10 Start: 9399742 End: 9400443
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1742232.8e-35
  PVGHFWLPEDGACMSWLDAQPVRSVVYVAFGSFTVFDRRQFQELALGLELTGRPFLWVVRPDIVHGDVHEYPDGFLDRVVASGINGGGRGKLVAWAPQQR
  VLAHPAVACFVSHCGWNSTMEGVRNGVPFVAWPYFADQFVNRAYICDIWR
Full Sequence
Protein Sequence     Length: 234     Download
MPVMHPAHLA WNCIGNDEGQ ELLFSCVLAG IRAIDECDYI LCNSFRGAEA ATFARFPKII    60
PVGPLLTGER PGKPVGHFWL PEDGACMSWL DAQPVRSVVY VAFGSFTVFD RRQFQELALG    120
LELTGRPFLW VVRPDIVHGD VHEYPDGFLD RVVASGINGG GRGKLVAWAP QQRVLAHPAV    180
ACFVSHCGWN STMEGVRNGV PFVAWPYFAD QFVNRAYICD IWRIGLPAVA DEK*          240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02173PLN021735.0e-3924226214+
PLN03004PLN030048.0e-4056226177+
PLN02167PLN021677.0e-4240214184+
PLN02562PLN025626.0e-4357226171+
PLN02555PLN025559.0e-5027226208+
Gene Ontology
GO TermDescription
GO:0005575cellular_component
GO:0008152metabolic process
GO:0016740transferase activity
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN04170.1012331232Hypothetical protein [Oryza sativa Japonica Group]
GenBankABB47186.1012331233Cytokinin-O-glucosyltransferase 2, putative [Oryza sativa (japonica cultivar-group)]
GenBankEAY78065.1012331233hypothetical protein OsI_33109 [Oryza sativa Indica Group]
GenBankEAZ15693.1012331233hypothetical protein OsJ_31105 [Oryza sativa Japonica Group]
GenBankEEC66745.101233151382hypothetical protein OsI_33106 [Oryza sativa Indica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A7e-3834226223418A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A8e-3424232194411A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A8e-3424232194411A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A8e-3424232194411A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B7e-3140226215397A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
DIBOA-glucoside biosynthesisRXN-7021EC-2.4.1.2022,4-dihydroxy-7-methoxy-2H-1,4-benzoxazin-3(4H)-one 2 -D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB62085618911890
EE18405824412330
EE03543324412330
EE04179623692330
CB62147516211620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00437.1Aquca_006_00442.1.683.867Aquca_006_00442.1.683.867Aquca_006_00439.1Aquca_1448_00001.1
Aquca_008_00220.1Aquca_002_00805.1Aquca_006_00438.1Aquca_006_00438.2Aquca_002_00813.1
Aquca_002_00811.1Aquca_006_00440.1Aquca_002_00814.1Aquca_002_00807.1Aquca_002_00812.1
Aquca_006_00441.1Aquca_006_00442.1.250.430Aquca_006_00442.1.250.430Aquca_014_00439.1Aquca_002_00808.1
Arabidopsis lyrata871488
Arabidopsis thalianaAT3G02100.1
Brachypodium distachyonBradi1g08157.1Bradi1g08177.1Bradi4g15800.1Bradi1g08190.1Bradi1g08150.1
Bradi1g08140.1Bradi1g08145.1Bradi3g17476.1Bradi1g63927.1
Brassica rapaBra039152
Carica papayaevm.TU.contig_41702.1
Capsella rubellaCarubv10013680m
Citrus clementinaCiclev10000944mCiclev10001112mCiclev10001080mCiclev10001067mCiclev10000928m
Ciclev10028395mCiclev10028394mCiclev10012482mCiclev10024412mCiclev10030167m
Ciclev10001071mCiclev10013686mCiclev10020076mCiclev10001095mCiclev10023795m
Ciclev10020077mCiclev10019991mCiclev10012136mCiclev10023293m
Citrus sinensisorange1.1g047662morange1.1g012652morange1.1g012083morange1.1g012314morange1.1g010617m
orange1.1g009851morange1.1g044266morange1.1g012212morange1.1g012744morange1.1g048435m
orange1.1g012594morange1.1g017266morange1.1g042709m
Cucumis sativusCucsa.221580.1
Eucalyptus grandisEucgr.B00577.1Eucgr.H02732.1.617.825Eucgr.H02732.1.617.825Eucgr.K02513.1Eucgr.K02516.1
Eucgr.H02732.1.188.390Eucgr.H02732.1.188.390Eucgr.K02510.1Eucgr.K02515.1Eucgr.H02711.1
Eucgr.H02712.1Eucgr.K02512.1Eucgr.H02703.1Eucgr.H02730.1Eucgr.H02704.1
Fragaria vescamrna04292.1-v1.0-hybridmrna04291.1-v1.0-hybridmrna04290.1-v1.0-hybridmrna25784.1-v1.0-hybridmrna25795.1-v1.0-hybrid
Glycine maxGlyma08g26840.1Glyma18g50110.2Glyma18g50110.1Glyma13g06170.1Glyma19g03600.1
Glyma05g04196.1Glyma19g03580.1Glyma18g50100.1Glyma18g50080.1Glyma13g06151.1
Glyma08g26790.1Glyma19g03611.1.284.406Glyma19g03611.1.284.406Glyma08g26830.1Glyma18g50090.1
Glyma01g21590.1Glyma19g03620.1Glyma08g26780.1Glyma18g50060.1Glyma01g21580.1
Glyma01g21620.1Glyma19g03611.1.66.202Glyma19g03611.1.66.202
Gossypium raimondiiGorai.007G082200.1Gorai.007G082200.3Gorai.007G082200.2Gorai.007G145900.1Gorai.012G048900.1
Gorai.008G197600.2Gorai.008G197600.1Gorai.008G197800.1Gorai.006G010800.1Gorai.007G145900.2
Gorai.008G197700.1
Linum usitatissimumLus10015746Lus10015750Lus10015751Lus10015753Lus10015745
Lus10003454Lus10003452Lus10034699Lus10003455Lus10015744
Lus10015749Lus10003453Lus10040533Lus10015748
Malus domesticaMDP0000176250MDP0000280885MDP0000302810MDP0000586116MDP0000592879
MDP0000230836MDP0000280886MDP0000270051MDP0000164967MDP0000322091
MDP0000772835
Manihot esculentacassava4.1_024855mcassava4.1_007374mcassava4.1_026903mcassava4.1_007626mcassava4.1_028065m
cassava4.1_022325mcassava4.1_031794mcassava4.1_030150mcassava4.1_024809mcassava4.1_023170m
cassava4.1_007623mcassava4.1_008181mcassava4.1_027192m
Medicago truncatulaMedtr7g013240.1Medtr7g013260.1Medtr7g013220.1Medtr7g013180.1Medtr7g013200.1
Mimulus guttatusmgv1a011424mmgv1a020666mmgv1a024777mmgv1a024506mmgv1a005998m
mgv1a012622m
Oryza sativaLOC_Os03g55010.1LOC_Os03g55030.2LOC_Os03g55030.1LOC_Os03g55050.1LOC_Os03g55020.1
LOC_Os10g17489.1LOC_Os10g18480.1LOC_Os10g18510.1LOC_Os03g55040.1
Panicum virgatumPavirv00049650mPavirv00010952mPavirv00064071mPavirv00056062mPavirv00003314m
Pavirv00032986mPavirv00009335mPavirv00059277mPavirv00056481mPavirv00061026m
Pavirv00061669mPavirv00029458mPavirv00004995mPavirv00004994mPavirv00062864m
Pavirv00052493mPavirv00052492mPavirv00058440mPavirv00062863mPavirv00052495m
Pavirv00056955mPavirv00056130mPavirv00025868mPavirv00007292m
Physcomitrella patensPp1s4_21V6.1Pp1s6_30V6.1Pp1s77_100V6.1
Phaseolus vulgarisPhvul.004G035300.1Phvul.004G035900.1Phvul.004G035700.1Phvul.004G035600.1Phvul.008G034300.1
Phvul.004G035800.1Phvul.004G036000.1Phvul.008G034200.1Phvul.008G034000.1Phvul.008G034100.1
Phvul.004G035500.1Phvul.008G035800.1Phvul.004G037100.1Phvul.004G036100.1Phvul.004G037000.1
Picea abiesMA_5333g0010MA_243g0020MA_10143270g0010MA_10165844g0010MA_134288g0010
MA_729922g0010MA_186971g0010MA_6422g0010MA_141053g0010MA_216575g0010
MA_10267586g0010MA_10426068g0020MA_69857g0010MA_4906g0020MA_9996672g0010
MA_19633g0010MA_119297g0010MA_671328g0010MA_192708g0010MA_10428499g0010
MA_28597g0010MA_870509g0010MA_79587g0010MA_10427763g0010.118.248MA_10427763g0010.118.248
MA_7388392g0010MA_10427763g0010.250.403MA_10427763g0010.250.403MA_376741g0010MA_44898g0020
MA_10431252g0010.257.402MA_10431252g0010.257.402MA_94043g0020MA_573449g0010MA_10426068g0010
MA_193320g0010MA_517290g0010MA_490343g0010MA_636498g0010MA_448717g0010
Populus trichocarpaPotri.017G091500.1Potri.010G084900.1Potri.004G123500.1Potri.004G119700.1Potri.013G022800.1
Prunus persicappa020470mppa006338mppa020867mppa019116mppa022508m
Ricinus communis29630.m00082829630.m00081730138.m00400030138.m00399429630.m000829
29630.m00081930138.m003997
Setaria italicaSi035615mSi035596mSi035605mSi039070mSi040036m
Si039735mSi035607mSi039435mSi035614mSi017089m
Si035627mSi035316mSi040193mSi040038mSi040112m
Si038689m
Selaginella moellendorffii10077111448111464111636111188
153665111946183183111739178031
4073122352939539816795795612
131108844239576584376447950
16235411588623122395938448116
4479496400084049177347430669.230.405
430669.230.4059559610430383942143651
2334882277841210985053102508
41752622903233672173967127526
4195792714598469513489912643
4127454384144062995957410681
1867671607242049179380128107
1779436393812803212791584680
419489412105441500168007407356
44046884016960268438797269
11011444170268664231443416242
9546415329430671430669.712.851430669.712.851
916322724315423411023
Sorghum bicolorSb01g007640.1Sb01g007630.1Sb05g005880.1Sb07g003850.1Sb01g007610.1
Sb01g007600.1Sb01g004090.1Sb01g007620.1
Thellungiella halophilaThhalv10020693m
Vitis viniferaGSVIVT01007898001.535.724GSVIVT01007898001.535.724GSVIVT01032927001GSVIVT01007898001.113.285GSVIVT01007898001.113.285
GSVIVT01032925001GSVIVT01032930001GSVIVT01032926001GSVIVT01012978001GSVIVT01007899001
GSVIVT01007892001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)