y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os10g30560.1
FamilyGT1
Protein PropertiesLength: 498 Molecular Weight: 53702.1 Isoelectric Point: 6.556
ChromosomeChromosome/Scaffold: 10 Start: 15893749 End: 15902927
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12614707.2e-37
  RPFYAVGPILPAGFARSAVATSMWAESDCSRWLAAQPPRSVLYVSFGSYAHVTRRELHEIARGVLASGARFLWVMRPDIVSSDDPDPLPDGFAAAAAADG
  RGVVVPWCCQVEVLAHPAVAAFLTHCGWNSILESAWAGVPMLCFPLLTDQFTNRRLVVREWRAGVAVGDRGAVDAGEVRARIEGVMRGEEGEVLREQVGK
  MRATLHAAVA
Full Sequence
Protein Sequence     Length: 498     Download
MGQQQPQDAV AANGNGGGKR PHAVVIPYPL QGHVIPAVHL ALRLAARGFA VTFVNTESVH    60
RQITSSGGGH GVGGGDDIFA GAGGGAMIRY ELVSDGFPLG FDRSRNHDQY MEGVLHVLPA    120
HVDELLRRVV GDGDAAAATC LVADTFFVWP ATLARKLGVP YVSFWTEPAI IFSLYYHMDL    180
LTKNGHFNCK EPRKDTITYV PGVEAIEPGE LMSYLQDTDT TTVVHRIIFR AFEEARGADY    240
VVCNTVEELE PSTIAALRRE RPFYAVGPIL PAGFARSAVA TSMWAESDCS RWLAAQPPRS    300
VLYVSFGSYA HVTRRELHEI ARGVLASGAR FLWVMRPDIV SSDDPDPLPD GFAAAAAADG    360
RGVVVPWCCQ VEVLAHPAVA AFLTHCGWNS ILESAWAGVP MLCFPLLTDQ FTNRRLVVRE    420
WRAGVAVGDR GAVDAGEVRA RIEGVMRGEE GEVLREQVGK MRATLHAAVA PGGSSRRGFD    480
ELVDELKRRC GGGGGRH*                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00164PLN001647.0e-50133489385+
PLN02173PLN021733.0e-5119489484+
PLN02152PLN021527.0e-5421486484+
PLN02555PLN025551.0e-7918489482+
PLN02448PLN024482.0e-9022483476+
Gene Ontology
GO TermDescription
GO:0005623cell
GO:0008152metabolic process
GO:0016740transferase activity
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34169.1014891476unknown [Zea mays]
DDBJBAF26610.2019149713319Os10g0442300 [Oryza sativa Japonica Group]
GenBankEAY78678.101749715505hypothetical protein OsI_33780 [Oryza sativa Indica Group]
RefSeqNP_001064696.101849714503Os10g0442300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002464565.1074923488hypothetical protein SORBIDRAFT_01g020920 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A0144862477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A0184794460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A0184794460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A0184794460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A9.80909e-458848864452A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG631249472204890
EE014094257883420
EE182757257883420
EC874735257883420
EE032160257883420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00088.1
Arabidopsis lyrata321400481703
Arabidopsis thalianaAT2G36970.1AT2G28080.1
Brachypodium distachyonBradi3g27610.1
Brassica rapaBra034386Bra005227Bra005229
Carica papayaevm.model.supercontig_1.23evm.model.supercontig_1.22
Capsella rubellaCarubv10023101mCarubv10025463m
Citrus clementinaCiclev10011571mCiclev10029902m
Citrus sinensisorange1.1g011789morange1.1g011724m
Cucumis sativusCucsa.385870.1
Eucalyptus grandisEucgr.B02537.1Eucgr.A01691.1
Fragaria vescamrna09620.1-v1.0-hybridmrna28972.1-v1.0-hybridmrna09619.1-v1.0-hybrid
Gossypium raimondiiGorai.003G144500.1
Linum usitatissimumLus10016127Lus10016128Lus10016126Lus10021438Lus10021437
Malus domesticaMDP0000184195MDP0000803674MDP0000148190MDP0000134856MDP0000696804
MDP0000279483MDP0000179216MDP0000128678
Manihot esculentacassava4.1_028045mcassava4.1_006927mcassava4.1_005956m
Mimulus guttatusmgv1a020724mmgv1a005852mmgv1a004928mmgv11b024665mmgv1a005283m
mgv1a005298mmgv1a005487mmgv1a005552mmgv1a023861mmgv1a004868m
mgv1a005354mmgv1a017916mmgv1a005271mmgv1a005954mmgv1a020141m
mgv1a026087mmgv1a019418m
Panicum virgatumPavirv00016210m
Picea abiesMA_20g0030MA_617328g0010MA_142317g0010MA_10436196g0010.108.287MA_10436196g0010.108.287
MA_57716g0010MA_10430346g0010MA_10436196g0010.563.731MA_10436196g0010.563.731MA_848089g0010
MA_343701g0010MA_111005g0010MA_10223011g0010MA_173000g0010MA_10281032g0010
MA_10259759g0010MA_10434721g0010MA_10434721g0020MA_10434576g0010MA_8498693g0010
MA_19907g0010MA_10426491g0010MA_220991g0010MA_10433786g0010MA_10108066g0010
MA_42695g0010MA_8452538g0010MA_10349694g0010MA_871006g0010MA_10434904g0020
Populus trichocarpaPotri.004G214100.2Potri.004G214100.1Potri.009G008100.1
Prunus persicappa004816mppa004829mppa020358mppa015843mppa023014m
ppa024090m
Ricinus communis29589.m001229
Setaria italicaSi035348mSi035373m
Sorghum bicolorSb01g020920.1
Thellungiella halophilaThhalv10016590mThhalv10016577mThhalv10017663m
Vitis viniferaGSVIVT01025724001GSVIVT01031515001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)