| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os10g39700.1 |
| Family | GH19 |
| Protein Properties | Length: 179 Molecular Weight: 18918.1 Isoelectric Point: 7.9151 |
| Chromosome | Chromosome/Scaffold: 10 Start: 21219485 End: 21222247 |
| Description | basic chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 35 | 161 | 5.32493e-44 |
| VGSVITEAVFNSMLPNRDNSLCPARGFYTYDAFIAAANSFPAFGTSGGSAELIRRELAAFFGQTSHETTDGTRGSSDQFQWGYCFKEEINKATSPPYYGR GPIQLTGRSNYQAARNALELDLVGDPT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 179 Download |
| MTTTTTTTRR FVQLAACAVA VLLAVAASGA AAQGVGSVIT EAVFNSMLPN RDNSLCPARG 60 FYTYDAFIAA ANSFPAFGTS GGSAELIRRE LAAFFGQTSH ETTDGTRGSS DQFQWGYCFK 120 EEINKATSPP YYGRGPIQLT GRSNYQAARN ALELDLVGDP TWCPPTPWSP SRRPSGSG* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3179 | COG3179 | 0.0007 | 131 | 159 | 29 | + Predicted chitinase [General function prediction only] | ||
| cd00442 | lysozyme_like | 0.0003 | 92 | 159 | 68 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
| pfam00182 | Glyco_hydro_19 | 1.0e-43 | 39 | 159 | 135 | + Chitinase class I. | ||
| cd00325 | chitinase_glyco_hydro_19 | 1.0e-44 | 39 | 159 | 134 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0005773 | vacuole |
| GO:0005829 | cytosol |
| GO:0006032 | chitin catabolic process |
| GO:0006950 | response to stress |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAL34317.1 | 0 | 5 | 160 | 2 | 157 | L40336_1 chitinase [Oryza sativa Indica Group] |
| DDBJ | BAA31997.1 | 0 | 5 | 160 | 2 | 157 | chitinase [Oryza sativa] |
| GenBank | EAY79390.1 | 0 | 5 | 160 | 2 | 157 | hypothetical protein OsI_34517 [Oryza sativa Indica Group] |
| RefSeq | NP_001065196.1 | 0 | 5 | 160 | 2 | 157 | Os10g0542900 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001065197.1 | 0 | 1 | 141 | 1 | 141 | Os10g0543400 [Oryza sativa (japonica cultivar-group)] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3cql_B | 8e-37 | 34 | 160 | 1 | 140 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| PDB | 3cql_A | 8e-37 | 34 | 160 | 1 | 140 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| PDB | 3w3e_B | 7e-33 | 35 | 160 | 3 | 139 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
| PDB | 3w3e_A | 7e-33 | 35 | 160 | 3 | 139 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
| PDB | 4dyg_B | 8e-33 | 35 | 160 | 3 | 141 | A Chain A, Structure Of Vigna Unguiculata Chitinase With Regulation Activity Of The Plant Cell Wall |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| chitin degradation II | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
| chitin degradation II | RXN-12623 | EC-3.2.1.14 | chitinase |
| chitin degradation II | RXN-12624 | EC-3.2.1.14 | chitinase |
| chitin degradation III (carnivorous plants) | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
