CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os11g13810.1
FamilyGH116
Protein PropertiesLength: 951 Molecular Weight: 106810 Isoelectric Point: 6.1506
ChromosomeChromosome/Scaffold: 11 Start: 7595274 End: 7606870
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165308910
  GQFLYLEGIEYYMWNTYDVHFYASFSLIMLFPKLQLSIQRDFAAAVLMHDPEKLRMLHDGKWVARKVLGAVPHDLGLYDPWFKVNAYTLYNTDRWKDLNP
  KFVLQVYRDVVATGDKSFARAVWPSVYMAMAYMEQFDRDKDGMIENEDFPDQTYDVWSMAGISAYCGGLWVAALQAASALAHEVGDKASEKLFWDKYEKA
  KSVYGKLWNGSYFNYDDGDNIMSASIHADQLAGQWYAKACGLFPIVDKDKAESALEKIYSFNVMKFKDGKRGAMNGMWPDGTVDMSAMQSREIWPGVTYA
  LAATMIQEGMVEKGFKTAEGIYHAAWSPEGLGYSFQTPEAWNNDDEYRSLCYMRPLAIWAIQ
Full Sequence
Protein Sequence     Length: 951     Download
MVENGVLEQP KGVSRNRPRA QSNDHPVDPG YLPELTWEHK LSNIGYDLPS FRLTWRETFQ    60
LAGLGLRLGR HILEETSKGR AAVIDPMKKR IAKSGQGVPL GGIGSGSIGR SYKGEFQRWQ    120
LFPGTCEERP VLANQFSAFI SRKDGRNYSS VLHPGKPDLP KGSNISGIGS WDWNMSGQNS    180
TYHALYPRSW TIYNGEPDPD VNIVCRQISP IIPHNYQQSS YPVSVFTFTV TNSGNTAADV    240
TLLFTWANSV GGKSELTGYH SNSPMIEKDG VHGILLHHRT ANGQPPVTFA IAAQEKEDIH    300
ISECPYFIIS GSSDAFSAKD MWNYVKENGS FDNLDLTKTS MCSKPGLSIG AAIAASVKLP    360
PQTTQNVSFA LAWACPEVKF SSGKTYHRRY TKFHGTDNDA AASLAHDAIL EHNSWERQIE    420
EWQNPILQDE RFPDWYPVTL FNELYYLNAG GTIWTDGLPP IQSLTGIGEK KFSLDMQNGD    480
ADDANGIIPR NNTASDILNQ MASVLERIHA SMESNSAIGT TLLQGEENIG QFLYLEGIEY    540
YMWNTYDVHF YASFSLIMLF PKLQLSIQRD FAAAVLMHDP EKLRMLHDGK WVARKVLGAV    600
PHDLGLYDPW FKVNAYTLYN TDRWKDLNPK FVLQVYRDVV ATGDKSFARA VWPSVYMAMA    660
YMEQFDRDKD GMIENEDFPD QTYDVWSMAG ISAYCGGLWV AALQAASALA HEVGDKASEK    720
LFWDKYEKAK SVYGKLWNGS YFNYDDGDNI MSASIHADQL AGQWYAKACG LFPIVDKDKA    780
ESALEKIYSF NVMKFKDGKR GAMNGMWPDG TVDMSAMQSR EIWPGVTYAL AATMIQEGMV    840
EKGFKTAEGI YHAAWSPEGL GYSFQTPEAW NNDDEYRSLC YMRPLAIWAI QWALSNPKLH    900
KQTADIPQDS FPKNQFSYAR IAKLLHLPED ESPKSFLRVI YEIVRNRYRS *             960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43548.0e-26133456334+
pfam12215GBA2_N2.0e-54115415309+
COG4354COG43542.0e-76529894385+
pfam04685DUF6082.0e-170530892367+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004348glucosylceramidase activity
GO:0006629lipid metabolic process
GO:0006665sphingolipid metabolic process
GO:0009056catabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX95400.108095026931At5g49900 [Oryza sativa Japonica Group]
GenBankEEC67936.1019501950hypothetical protein OsI_35656 [Oryza sativa Indica Group]
RefSeqNP_001067588.1019501950Os11g0242100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002264575.1019471946PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002450573.1019501951hypothetical protein SORBIDRAFT_05g007160 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6187132763326070
CB6227322674196850
DY2920403595438980
GR3355472684337000
FF3541752794707470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)