y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os11g45710.5
FamilyGH1
Protein PropertiesLength: 648 Molecular Weight: 73271.2 Isoelectric Point: 6.7231
ChromosomeChromosome/Scaffold: 11 Start: 27650599 End: 27655231
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11455480
  RVAMEAMLRGFEILAESGESAGGDNCSHNVAAWHNVPCPQERLRFWSDPDAELKLAKETGISVFRMGVDWARLMPEEPTEELKSSVNFAALERYRWIIQR
  VREYGMKVMLTLFHHSLPPWAGKYGGWKMEKTVTYFMDFVRLVVDRVSNLVDYWVIFNEPHVFVMLTYCAGAWPGGDPNAIEVATSTLPTGVYNQALHWM
  AIAHSEAYDYIHSKSKNERKPIVGVAHHVSFTRPYGLFDVAAVALANSLTLFPYVDSICDKLDFIGINYYGQEVISGPGLKLVDNDEYSESGRGVYPDGL
  FRILIQFNERYKRLNIPFVITENGVSDETDLIRKPYILEHLLATYAAIIMGVRVLGYLFWTTSDNWEWADGYGPKFGLVAVDRANNLARKPRPSYFLFSR
  VVTT
Full Sequence
Protein Sequence     Length: 648     Download
MPLPAFVAAA ARLAVLVAAA ATAANAASYA RYRRRHLRRI PSPIDESADP LADFRAFPSS    60
DADDSEEDNF FFGLATAPAH VEDRLEDAWL QFATETSCDD NGNVRDQRPV DALMASAAGD    120
GGSQQSWRST GGENIGDREQ RKPLRVAMEA MLRGFEILAE SGESAGGDNC SHNVAAWHNV    180
PCPQERLRFW SDPDAELKLA KETGISVFRM GVDWARLMPE EPTEELKSSV NFAALERYRW    240
IIQRVREYGM KVMLTLFHHS LPPWAGKYGG WKMEKTVTYF MDFVRLVVDR VSNLVDYWVI    300
FNEPHVFVML TYCAGAWPGG DPNAIEVATS TLPTGVYNQA LHWMAIAHSE AYDYIHSKSK    360
NERKPIVGVA HHVSFTRPYG LFDVAAVALA NSLTLFPYVD SICDKLDFIG INYYGQEVIS    420
GPGLKLVDND EYSESGRGVY PDGLFRILIQ FNERYKRLNI PFVITENGVS DETDLIRKPY    480
ILEHLLATYA AIIMGVRVLG YLFWTTSDNW EWADGYGPKF GLVAVDRANN LARKPRPSYF    540
LFSRVVTTGK ITRQDRMSAW RELQQAAVQK KTRPFFRAVD KHGRMYAGGL DRPIQRPFIL    600
RDWRFGHYKM EGLQDPLSCF IRCIFAPFSR QKKIHYIEDD VISYSIN*                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG3.0e-20183526417+
PRK13511PRK135111.0e-21184551457+
TIGR03356BGL8.0e-48197542391+
pfam00232Glyco_hydro_15.0e-49194548411+
COG2723BglB2.0e-62197552414+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0006950response to stress
GO:0008152metabolic process
GO:0009536plastid
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22735.1016471650beta-glycosidase [Brachypodium distachyon]
GenBankACL54550.102864728655unknown [Zea mays]
GenBankEAY81793.104064740646hypothetical protein OsI_36965 [Oryza sativa Indica Group]
RefSeqNP_001068463.1016471647Os11g0683500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105868.102864728657putative beta-glycosidase [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1vff_A1e-3819055149408A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii
PDB3apg_D5e-3818255451460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C5e-3818255451460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_B5e-3818255451460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_A5e-3818255451460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8410083252105340
GO8386793223116320
GO8544993302175460
GO8579233062235280
GO857923435285700.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10043048Lus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.6
LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny