| Basic Information | |
|---|---|
| Species | Oryza sativa |
| Cazyme ID | LOC_Os12g02080.2 |
| Family | AA2 |
| Protein Properties | Length: 188 Molecular Weight: 20176.6 Isoelectric Point: 9.2305 |
| Chromosome | Chromosome/Scaffold: 12 Start: 623549 End: 626113 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 3 | 167 | 1.5e-27 |
| LGGPSWDVKVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQALSQKDMVALSGSHTIGQARCTNFRAHIYNETNIDSGFAMRRQSGCPRNSGSGDNN LAPLDLQTPTVFENNYYKNLVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 188 Download |
| MQLGGPSWDV KVGRRDSRTA SLSGANNNIP PPTSGLANLT SLFAAQALSQ KDMVALSGSH 60 TIGQARCTNF RAHIYNETNI DSGFAMRRQS GCPRNSGSGD NNLAPLDLQT PTVFENNYYK 120 NLVVKKGLLH SDQELFNGGA TDALVQSYIS SQSTFFADFV TGMIKMGDIT PLTGSNGEIR 180 KNCRRIN* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00141 | peroxidase | 0.001 | 120 | 148 | 29 | + Peroxidase. | ||
| cd00314 | plant_peroxidase_like | 1.0e-17 | 1 | 167 | 186 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| pfam00141 | peroxidase | 5.0e-18 | 3 | 62 | 60 | + Peroxidase. | ||
| PLN03030 | PLN03030 | 5.0e-33 | 5 | 187 | 195 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 2.0e-84 | 3 | 186 | 191 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003824 | catalytic activity |
| GO:0004601 | peroxidase activity |
| GO:0005515 | protein binding |
| GO:0005576 | extracellular region |
| GO:0005618 | cell wall |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAY79693.1 | 0 | 3 | 187 | 145 | 329 | hypothetical protein OsI_34840 [Oryza sativa Indica Group] |
| RefSeq | NP_001065568.1 | 0 | 3 | 187 | 140 | 324 | Os11g0112400 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001065971.1 | 0 | 3 | 187 | 143 | 327 | Os12g0112000 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002450132.1 | 0 | 3 | 187 | 147 | 331 | hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor] |
| RefSeq | XP_002450133.1 | 0 | 3 | 187 | 144 | 328 | hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1sch_B | 0 | 1 | 187 | 110 | 294 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 0 | 1 | 187 | 110 | 294 | A Chain A, Peanut Peroxidase |
| PDB | 1qo4_A | 0 | 4 | 187 | 114 | 304 | A Chain A, Peanut Peroxidase |
| PDB | 1pa2_A | 0 | 4 | 187 | 114 | 304 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 4a5g_B | 0 | 4 | 187 | 115 | 305 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FL933138 | 188 | 1 | 188 | 0 |
| CN136566 | 186 | 3 | 188 | 0 |
| CN128405 | 186 | 3 | 188 | 0 |
| CN131113 | 186 | 3 | 188 | 0 |
| CN136942 | 186 | 3 | 188 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |