CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os12g03470.4
FamilyGH51
Protein PropertiesLength: 661 Molecular Weight: 72878 Isoelectric Point: 5.1511
ChromosomeChromosome/Scaffold: 12 Start: 1359586 End: 1366649
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511826500
  LASSTIPVSGASNWTKLEQKLVAKGTNRTSRLQITTTKKGVVWFDQVSLMSADTYKGHGFRTELISMMLDLKPRFLRFPGGCFVEGEWLRNAFRWRESIG
  PWEERPGHFGDVWHYWTDDGLGYYEFLQLSEDLGAAPIWVFNNGISHNDEVDTAAIAPFVKDVLDSLEFARGSADSTWGSVRAAMGHPEPFPVKYVAIGN
  EDCGKKFYRGNYLKFYNAIREAYPDIQMISNCDASSRPLDHPADLYDFHVYTDSKTLFSMKSAFDRSSRNGPKAFVSEYAVWRSDAGRGSLLASLAEAAF
  LTGLEKNSDVVQMASYAPLFVNNNDQTWNPDAIVFNSWQQYGTPSYWMQTLFRESSGAMFHPITITSSYSGSLAASAITWQDSENSFLRVKIINFGSDPV
  SLTISATGLQARVNALGSTATVITSSNVMDENSFSNPNKVVPVKSQLSNAAEQMQVTLAPHSFSSFDLA
Full Sequence
Protein Sequence     Length: 661     Download
MGSREPFLSA IFFFFFLLLF CLGCKCIASE LHLHTTQTAV LKVDASLQHA RQIPDTLFGI    60
FFEEINHAGA GGIWAELVSN RGFEAGGPHT PSNIDPWSII GDDSSIFVAT DRTSCFSRNT    120
VALRMEVLCD NCPAGGVGIY NPGFWGMNIE DGKTYNLVMY VKSPETVELT VSLTSSDGSQ    180
NLASSTIPVS GASNWTKLEQ KLVAKGTNRT SRLQITTTKK GVVWFDQVSL MSADTYKGHG    240
FRTELISMML DLKPRFLRFP GGCFVEGEWL RNAFRWRESI GPWEERPGHF GDVWHYWTDD    300
GLGYYEFLQL SEDLGAAPIW VFNNGISHND EVDTAAIAPF VKDVLDSLEF ARGSADSTWG    360
SVRAAMGHPE PFPVKYVAIG NEDCGKKFYR GNYLKFYNAI REAYPDIQMI SNCDASSRPL    420
DHPADLYDFH VYTDSKTLFS MKSAFDRSSR NGPKAFVSEY AVWRSDAGRG SLLASLAEAA    480
FLTGLEKNSD VVQMASYAPL FVNNNDQTWN PDAIVFNSWQ QYGTPSYWMQ TLFRESSGAM    540
FHPITITSSY SGSLAASAIT WQDSENSFLR VKIINFGSDP VSLTISATGL QARVNALGST    600
ATVITSSNVM DENSFSNPNK VVPVKSQLSN AAEQMQVTLA PHSFSSFDLA LAQSKLVAEM    660

Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA7.0e-34240645482+
pfam06964Alpha-L-AF_C6.0e-37458643203+
smart00813Alpha-L-AF_C3.0e-50458643198+
Gene Ontology
GO TermDescription
GO:0005576extracellular region
GO:0005618cell wall
GO:0005773vacuole
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC67598.1016601658hypothetical protein OsI_34967 [Oryza sativa Indica Group]
GenBankEEC68793.1016601657hypothetical protein OsI_37345 [Oryza sativa Indica Group]
GenBankEEE52698.1016501648hypothetical protein OsJ_35098 [Oryza sativa Japonica Group]
RefSeqNP_001065660.1016601658Os11g0131900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001066062.1016601660Os12g0128700 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L2e-2224065148483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K2e-2224065148483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J2e-2224065148483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I2e-2224065148483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H2e-2224065148483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0486153482856310
GT0462043482255720
GO801860329934210
GT036166336253600
HO8526834262406610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.3LOC_Os12g03470.2
LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1LOC_Os12g03470.5
LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)