| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10000070 |
| Family | GH17 |
| Protein Properties | Length: 87 Molecular Weight: 9967.59 Isoelectric Point: 5.8305 |
| Chromosome | Chromosome/Scaffold: 8298313 Start: 205 End: 465 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 6 | 85 | 6.6e-21 |
| PAAQTFESPALRKLLEFHLRTRTPFMVNPYPFLKVWGGYPDLDYAVFRENKGVLDKATGKMYTNMLDEMLDAVYVSMKKL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 87 Download |
| MSEIDPAAQT FESPALRKLL EFHLRTRTPF MVNPYPFLKV WGGYPDLDYA VFRENKGVLD 60 KATGKMYTNM LDEMLDAVYV SMKKLD* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-9 | 6 | 85 | 86 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAV48782.1 | 1e-20 | 9 | 85 | 66 | 140 | glucanase [Linum usitatissimum] |
| EMBL | CAN83700.1 | 0.000000000000001 | 19 | 85 | 65 | 129 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI23036.1 | 0.000000000000002 | 9 | 85 | 174 | 248 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002271991.1 | 0.000000000000002 | 9 | 85 | 174 | 248 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002532848.1 | 0.000000000000001 | 19 | 85 | 184 | 248 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ghs_B | 0.0000002 | 6 | 84 | 139 | 219 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghs_A | 0.0000002 | 6 | 84 | 139 | 219 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghr_A | 0.0000006 | 6 | 84 | 138 | 220 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1aq0_B | 0.0000006 | 6 | 84 | 138 | 220 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 0.0000006 | 6 | 84 | 138 | 220 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| Hydropathy |
|---|
 |
