y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10000225
FamilyGH1
Protein PropertiesLength: 335 Molecular Weight: 37131 Isoelectric Point: 7.5933
ChromosomeChromosome/Scaffold: 8379053 Start: 51 End: 2847
Descriptionbeta-glucosidase 47
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111980
  MRQYLGATLPSFTAEQMGYVKGSIDFIGLNHYSALYAKDCLYSSCPPGGSDHAIRGYVYTTGERDGVTIGPPTGNVRFFVVPSGMENIVNYLKKRYNNMP
  LYVTENGYGPPPDEAEQLQQILEDSSRIGYHKSYIAALARSIRDGADVRGYFVWSLMDNFEWVDGYTVRYGLYYVDRQTLDRIPKKSAMWYKHFLANS
Full Sequence
Protein Sequence     Length: 335     Download
MRQYLGATLP SFTAEQMGYV KGSIDFIGLN HYSALYAKDC LYSSCPPGGS DHAIRGYVYT    60
TGERDGVTIG PPTGNVRFFV VPSGMENIVN YLKKRYNNMP LYVTENGYGP PPDEAEQLQQ    120
ILEDSSRIGY HKSYIAALAR SIRDGADVRG YFVWSLMDNF EWVDGYTVRY GLYYVDRQTL    180
DRIPKKSAMW YKHFLANSSA QTAGLSLVPG RLHETLINNG VVDTICDLVV FAASGGASEK    240
LASGLLQPFV SHLKTASDQI SKGGYSIILR PSSSPNTSTP WFTKATLQRF VRFVSTPEVL    300
ERFVTIETEL EQIESSVHSH ELYKSTVSSK VCSK*                               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13511PRK135111.0e-3425193180+
PLN02849PLN028499.0e-351200202+
PLN02814PLN028141.0e-351195203+
TIGR03356BGL3.0e-441191193+
pfam00232Glyco_hydro_18.0e-581197200+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20347.101202306505unnamed protein product [Vitis vinifera]
RefSeqXP_002281979.101222353567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281986.101198309505PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329151.101195277469predicted protein [Populus trichocarpa]
RefSeqXP_002448179.101195315509hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B4.2039e-451195310503A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed With Maltose
PDB3ptq_A4.2039e-451195310503A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed With Maltose
PDB3ptm_B4.2039e-451195310503A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed With Maltose
PDB3ptm_A4.2039e-451195310503A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed With Maltose
PDB3ptk_B4.2039e-451195310503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW868401150732220
GW868401731730
JG248645169722400
CX29079620212020
ES80341220012000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_346_00002.1
Eucalyptus grandisEucgr.K00923.1
Fragaria vescamrna26801.1-v1.0-hybrid
Glycine maxGlyma11g13766.2Glyma08g15960.5Glyma08g15993.1Glyma08g15960.4Glyma08g15950.2
Gossypium raimondiiGorai.008G271500.8.159.363Gorai.008G271500.8.159.363
Linum usitatissimumLus10011828.473.717Lus10011828.473.717
Malus domesticaMDP0000285510MDP0000295323MDP0000187265
Medicago truncatulaMedtr4g015460.2
Mimulus guttatusmgv1a025884mmgv1a014264m
Oryza sativaLOC_Os04g39814.3
Panicum virgatumPavirv00040514mPavirv00034317mPavirv00068709m
Phaseolus vulgarisPhvul.011G055700.2
Picea abiesMA_173229g0010
Populus trichocarpaPotri.T019200.1.296.514Potri.T177800.2Potri.T019200.1.296.514Potri.T177800.1Potri.T177800.3
Prunus persicappa026358mppa015721m
Vitis viniferaGSVIVT01032017001GSVIVT01032006001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny