Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10000817 |
Family | GT8 |
Protein Properties | Length: 220 Molecular Weight: 24567.4 Isoelectric Point: 8.0193 |
Chromosome | Chromosome/Scaffold: 1405 Start: 39337 End: 40561 |
Description | plant glycogenin-like starch initiation protein 6 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT8 | 22 | 196 | 9.6e-31 |
PPKRTQSAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVALVSDGVSDYAKRLLEADGWMVETISLLANPNQIRPTRFWGVYTKLKIFNMTNYQKVGLAN PLKYLDADTIVVKDIEDLFQCSKFCANLKHSERLNSGVMVVEPSEALFNDMFAKVNTMYSYTGGDQGFLNSYYPD |
Full Sequence |
---|
Protein Sequence Length: 220 Download |
MKLTQLCLLL AVVFLHSAAA LPPKRTQSAY VTLLYGDEFL LGVRVLGKSI RDTGSKKDMV 60 ALVSDGVSDY AKRLLEADGW MVETISLLAN PNQIRPTRFW GVYTKLKIFN MTNYQKVGLA 120 NPLKYLDADT IVVKDIEDLF QCSKFCANLK HSERLNSGVM VVEPSEALFN DMFAKVNTMY 180 SYTGGDQGFL NSYYPDFPNA RLFEPGLSKE ERISRAVPD* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN00176 | PLN00176 | 1.0e-10 | 16 | 196 | 223 | + galactinol synthase | ||
cd06914 | GT8_GNT1 | 6.0e-11 | 29 | 197 | 179 | + GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases. | ||
cd00505 | Glyco_transf_8 | 2.0e-11 | 29 | 194 | 204 | + Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+. | ||
pfam01501 | Glyco_transf_8 | 2.0e-19 | 31 | 196 | 207 | + Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase. | ||
cd02537 | GT8_Glycogenin | 2.0e-63 | 29 | 197 | 175 | + Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0016757 | transferase activity, transferring glycosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAL58891.1 | 0 | 1 | 218 | 4 | 215 | AF462795_1 AT5g18480/F20L16_200 [Arabidopsis thaliana] |
EMBL | CAN77613.1 | 0 | 8 | 218 | 11 | 214 | hypothetical protein [Vitis vinifera] |
RefSeq | NP_197349.2 | 0 | 1 | 218 | 4 | 215 | PGSIP6 (PLANT GLYCOGENIN-LIKE STARCH INITIATION PROTEIN 6); transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana] |
RefSeq | XP_002266145.1 | 0 | 8 | 218 | 11 | 214 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002319122.1 | 0 | 1 | 219 | 1 | 220 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3usq_A | 6e-17 | 26 | 194 | 22 | 191 | A Chain A, Structure Of D159sY194F GLYCOGENIN MUTANT TRUNCATED AT RESIDUE 270 |
PDB | 3v91_A | 1e-16 | 26 | 194 | 22 | 191 | A Chain A, Structure Of D159sY194F GLYCOGENIN MUTANT TRUNCATED AT RESIDUE 270 |
PDB | 3v90_A | 1e-16 | 26 | 194 | 22 | 191 | A Chain A, Structure Of T82m Glycogenin Mutant Truncated At Residue 270 |
PDB | 3usr_A | 1e-16 | 26 | 194 | 22 | 191 | A Chain A, Structure Of Y194f Glycogenin Mutant Truncated At Residue 270 |
PDB | 3v8z_A | 1e-16 | 26 | 194 | 22 | 191 | A Chain A, Structure Of Y194f Glycogenin Mutant Truncated At Residue 270 |