| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10001740 |
| Family | CBM43 |
| Protein Properties | Length: 89 Molecular Weight: 10004.1 Isoelectric Point: 7.8973 |
| Chromosome | Chromosome/Scaffold: 561 Start: 45738 End: 46173 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 6 | 83 | 9.6e-28 |
| RTNTGWLQSAMTWACEKGRADCSKVQANQHCFWPNTTIDHASYVFNNYFQQFKHTGGSCYFNGAGIVTYLDPSHGSCQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 89 Download |
| MVHSRRTNTG WLQSAMTWAC EKGRADCSKV QANQHCFWPN TTIDHASYVF NNYFQQFKHT 60 GGSCYFNGAG IVTYLDPSHG SCQFEFIA* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 9.0e-11 | 12 | 71 | 65 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-26 | 12 | 84 | 73 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK92842.1 | 8e-31 | 2 | 87 | 33 | 118 | unknown [Populus trichocarpa] |
| EMBL | CBI28425.1 | 5e-31 | 2 | 87 | 31 | 116 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002272811.1 | 3e-31 | 2 | 86 | 32 | 116 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002272918.1 | 3e-31 | 2 | 86 | 32 | 116 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002321180.1 | 9e-35 | 2 | 86 | 31 | 115 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.0000000007 | 12 | 85 | 25 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DN488535 | 85 | 2 | 86 | 8e-34 |
| CV271912 | 85 | 2 | 86 | 9e-34 |
| DN498220 | 81 | 6 | 86 | 4e-33 |
| CV230089 | 85 | 2 | 86 | 5e-33 |
| DT469658 | 85 | 2 | 86 | 5e-33 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
