y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10001833
FamilyCBM49
Protein PropertiesLength: 619 Molecular Weight: 68080.4 Isoelectric Point: 8.3463
ChromosomeChromosome/Scaffold: 3494 Start: 90131 End: 92954
Descriptionglycosyl hydrolase 9C2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495276039.5e-36
  SIKQKMTASWSHQGETYYRYSTIVTNNSPKAVSNLKLYINKLYGPVWGVTKSRDSYGFPAWIKFLAAGKSIEFVYIH
GH9234830
  DYGQALSKSILFFEAQRSGFLPHNQRVTWRSNSGLADGKASGVDLTGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELRNAMEAIKWGTDYF
  IKAHPEPDVLYGEVGDGTTDHYCWQRPEDMTTDRRAYRIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSHELLNHAYQLFDFANKHRGKYDSSITVAQ
  KYYHSISGYNDELLWAAAWLYQASSNEYYLNYLAANGDALGGTGWAMTEFGWDVKYAGVQTLVSKILMQGRAGRHAPVFEKYQQKAEYFMCSCLGKGRSI
  KKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLSSARKNLHCSSAAVSPSDLLAFAKSQVDYILGDNPRATSYMVGYGNNYPQQVHHRASSIVSYKKDPS
  PISCRGGYATWFSRKESDPNLLTGAIVGGPDAYDNFADQRDNYEQTEPATYNNAPLLGILA
Full Sequence
Protein Sequence     Length: 619     Download
MAAASLFLLF ILSSFQHAFA GHDYGQALSK SILFFEAQRS GFLPHNQRVT WRSNSGLADG    60
KASGVDLTGG YYDAGDNVKF GLPMAFTVTM MSWSIIEYGK QMAASGELRN AMEAIKWGTD    120
YFIKAHPEPD VLYGEVGDGT TDHYCWQRPE DMTTDRRAYR IDPSNPGSDL AGETAAAMAA    180
ASIVFRHSDP AYSHELLNHA YQLFDFANKH RGKYDSSITV AQKYYHSISG YNDELLWAAA    240
WLYQASSNEY YLNYLAANGD ALGGTGWAMT EFGWDVKYAG VQTLVSKILM QGRAGRHAPV    300
FEKYQQKAEY FMCSCLGKGR SIKKTPGGLI FRQRWNNMQF VTSASFLATV YSDYLSSARK    360
NLHCSSAAVS PSDLLAFAKS QVDYILGDNP RATSYMVGYG NNYPQQVHHR ASSIVSYKKD    420
PSPISCRGGY ATWFSRKESD PNLLTGAIVG GPDAYDNFAD QRDNYEQTEP ATYNNAPLLG    480
ILARLSAGHS GYSQLLPEAV LPAPAQKVET PKATVIPAPA STSGPFSIKQ KMTASWSHQG    540
ETYYRYSTIV TNNSPKAVSN LKLYINKLYG PVWGVTKSRD SYGFPAWIKF LAAGKSIEFV    600
YIHTAPAADV SVSSYSLT*                                                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN02171018618605+
PLN02340PLN02340018615602+
PLN02420PLN02420020485469+
PLN00119PLN00119023486465+
pfam00759Glyco_hydro_9023483464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAC94006.102161725619endo-beta-1,4-glucanase [Fragaria x ananassa]
EMBLCAI68019.102161725619endo-beta-1,4-glucanase [Prunus persica]
EMBLCAI68020.102161725619endo-beta-1,4-glucanase [Prunus persica]
RefSeqXP_002299478.1056179621predicted protein [Populus trichocarpa]
RefSeqXP_002303645.102061824622glycosyl hydrolase family 9 [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0224873430A Chain A, Crystal Structure Of A Mutant Of Acid Phosphatase From Escherichia Blattae (g74d/i153t)
PDB1ksc_A0224873430A Chain A, Crystal Structure Of A Mutant Of Acid Phosphatase From Escherichia Blattae (g74d/i153t)
PDB1ks8_A0224873430A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A02348525459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0235225475B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783495378264020
ES821522357263790
DW0690633111364450
DY9226283061414450
DY9228463001414390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)