y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10006462
FamilyGH5
Protein PropertiesLength: 574 Molecular Weight: 63924.1 Isoelectric Point: 7.1116
ChromosomeChromosome/Scaffold: 743 Start: 211348 End: 213797
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5463557.10038e-42
  EATGRRVKLACVNLASHLEPMVAEGLNRLPINVIAQKITSMGFNCVRLTWPLYLVTNATLGSITVRQSFRRLQLLEPIRGIQAHNPWIIDVSLLQAFKEV
  VRKLGENNVMVVLDNHVTKPGWCCRDYDGNGFFGDEYFSPDLWVEGLTRMATMFKGSRNVVAMSLRNELRGPKQNSNDWYRYMTRGAEAVHTANPDVLVI
  LSGLNYDGDLSFLNVEPVKLTFSKKLVFEVHWYGFTDGDGWKNGNPNQVCGLVIDHLRKSAGFVLDKEYPLFVSEFGIDQSGGNVNDDRFINCFLGYAAE
  LDLDWAVWTV
Full Sequence
Protein Sequence     Length: 574     Download
MAKNQLRNHS LVVSLLLIFI SSSSISHIRE VSALPLSTES RWIVDEATGR RVKLACVNLA    60
SHLEPMVAEG LNRLPINVIA QKITSMGFNC VRLTWPLYLV TNATLGSITV RQSFRRLQLL    120
EPIRGIQAHN PWIIDVSLLQ AFKEVVRKLG ENNVMVVLDN HVTKPGWCCR DYDGNGFFGD    180
EYFSPDLWVE GLTRMATMFK GSRNVVAMSL RNELRGPKQN SNDWYRYMTR GAEAVHTANP    240
DVLVILSGLN YDGDLSFLNV EPVKLTFSKK LVFEVHWYGF TDGDGWKNGN PNQVCGLVID    300
HLRKSAGFVL DKEYPLFVSE FGIDQSGGNV NDDRFINCFL GYAAELDLDW AVWTVAGSYY    360
LGEGVVGMSE PYGLLNSDWV EIRNTAFLEK LSALQRPFQG PGLEEVKLHK VIFHPSTGLC    420
VHRGRTDSEP LKLGPCSRSD PWSYDKKTLS VMGTHLCLMA QQLSKPAQIQ LEYCPTWEMI    480
TDSGMHLSSK LQDGTPVCLD VDSNNNSDIV TSPCKCLKAE DTKCDPGSQW FKLVDSTRRG    540
NGKGLPSGTN RLTRGGFSSG RSLLWEFLSL ALA*                                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00161RICIN0.001410514119+
pfam00150Cellulase9.0e-1875354285+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_172772.203353832537glycosyl hydrolase family 5 protein / cellulase family protein [Arabidopsis thaliana]
RefSeqXP_002285424.102853721529PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312657.10295685541predicted protein [Populus trichocarpa]
RefSeqXP_002315653.10335382506predicted protein [Populus trichocarpa]
RefSeqXP_002515055.103057128566hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1vrx_B0.0000000001383228284A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1vrx_A0.0000000001383228284A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1ece_B0.0000000006383228284A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1ece_A0.0000000006383228284A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB2zun_C0.0015239661407A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
Signal Peptide
Cleavage Site
33
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG2129482633125740
DY977776290683570
DY972279289323190
DW160634286323160
DY905374287703560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00429.2Aquca_011_00429.1Aquca_001_00170.1Aquca_001_00171.1Aquca_011_00425.1
Aquca_011_00424.1Aquca_011_00428.1Aquca_011_00423.1Aquca_001_00172.1
Arabidopsis lyrata471466322756864961488616326109
882032
Arabidopsis thalianaAT5G17500.1AT1G13130.1AT3G26140.1AT3G26130.1AT5G16700.1
Brachypodium distachyonBradi5g13560.1Bradi5g13550.1
Brassica rapaBra025186Bra019811Bra025187Bra026437Bra026436
Bra023580Bra013972Bra008603Bra026925
Carica papayaevm.model.supercontig_33.65evm.model.supercontig_33.69evm.model.supercontig_33.67
Capsella rubellaCarubv10008758mCarubv10019167mCarubv10016955mCarubv10002868m
Citrus clementinaCiclev10031098mCiclev10023534m
Citrus sinensisorange1.1g013842morange1.1g008330morange1.1g015062morange1.1g039248m
Cucumis sativusCucsa.286780.1Cucsa.275330.1Cucsa.115540.1Cucsa.108400.1Cucsa.115550.1
Cucsa.365480.1Cucsa.303610.1Cucsa.303620.1Cucsa.129000.1Cucsa.275320.1
Eucalyptus grandisEucgr.B03243.1Eucgr.H02462.1Eucgr.H02464.1Eucgr.H02457.1Eucgr.H02458.1
Eucgr.D01800.1
Glycine maxGlyma05g30691.1Glyma11g18350.1Glyma05g30681.1Glyma08g13880.2Glyma18g01630.1
Glyma08g13891.1Glyma08g06511.1Glyma07g08060.2
Gossypium raimondiiGorai.002G188600.1Gorai.012G173600.1
Linum usitatissimumLus10011404Lus10011403Lus10006461Lus10024686Lus10032312
Malus domesticaMDP0000753366MDP0000729817
Manihot esculentacassava4.1_004696mcassava4.1_031675mcassava4.1_025125m
Medicago truncatulaMedtr4g091610.1Medtr7g012780.1Medtr7g012530.1Medtr3g086450.1Medtr7g012540.1
Medtr7g012840.1Medtr5g088330.1
Mimulus guttatusmgv1a004205mmgv1a018920mmgv1a020519mmgv1a004243mmgv1a004297m
Oryza sativaLOC_Os04g40510.2LOC_Os04g40510.1LOC_Os02g38260.1LOC_Os04g40500.1LOC_Os04g40490.1
Panicum virgatumPavirv00025159mPavirv00029795mPavirv00010845mPavirv00023661mPavirv00002791m
Pavirv00002936m
Physcomitrella patensPp1s94_121V6.1Pp1s114_176V6.1Pp1s298_71V6.1
Phaseolus vulgarisPhvul.002G258500.1Phvul.011G098000.1Phvul.002G258400.1Phvul.002G220300.1Phvul.010G095100.1
Picea abiesMA_318998g0010MA_463555g0010MA_8507901g0010MA_10432675g0010
Populus trichocarpaPotri.008G183400.2Potri.008G183400.1Potri.010G049700.1Potri.010G049800.1Potri.008G183400.3
Potri.001G097900.1Potri.T144300.1
Prunus persicappa003807m
Ricinus communis29929.m00479230190.m01129330190.m01129230190.m011291
Setaria italicaSi019475mSi009742mSi009751mSi009695m
Sorghum bicolorSb06g020270.1Sb06g020260.1Sb04g024910.1
Thellungiella halophilaThhalv10007253mThhalv10003934mThhalv10004045mThhalv10003968mThhalv10015581m
Thhalv10015466m
Vitis viniferaGSVIVT01000573001GSVIVT01019434001.470.783GSVIVT01019434001.470.783GSVIVT01019434001.35.351GSVIVT01019434001.35.351
GSVIVT01019433001GSVIVT01019436001GSVIVT01014359001GSVIVT01014358001GSVIVT01014355001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)